2C27


Conserved Protein Domain Family
mycothiol_MshD

?
TIGR03448: mycothiol_MshD 
Click on image for an interactive view with Cn3D
mycothiol synthase
Members of this family are MshD, the acetyltransferase that catalyzes the final step of mycothiol biosynthesis in various members of the Actinomyctes, Mycothiol replaces glutathione in these species. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs]
Statistics
?
PSSM-Id: 132489
View PSSM: TIGR03448
Aligned: 12 rows
Threshold Bit Score: 328.977
Threshold Setting Gi: 111220403
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2C27_A         5 DWRSALTADEQRSVRALVTATTAVDGVAPVGEQVLREL---GQ-QRTEHLLVA--------GS---------RPgg--pI 61
gi 699204      5 NWRFALSADEQRLVREIISAATEFDEVSPVGEQVLREL---GY-DRTEHLLVT--------DS---------RPya--pI 61
gi 500043021   5 DWRRTLNPQEQREVRELVGAATEFDAVAPVGEQVLREL---GH-DRTEHLLIR--------GSvsg---gaaDA-----V 64
gi 499916427   7 SWTDRLDGKQAADVSALLERATAADGTAPVSEQGVHAVsgaGS-DGVRHLVET--------DA---------DR-----I 63
gi 499881167   5 DWRSALTDDEQGSIRDIVAAATRHDGVAPVGDQVLREL---PA-DRTRHLVAV--------DP---------DAg---aV 60
gi 499520491   7 RWTQRLDGETADAVRELLAAASAADGVAPVSEQAVLSLgepGA---ARHLLAE--------HD---------GE-----L 61
gi 499324733   9 STQIALDRDLREQALLLLKEVRAVDGVDALSEQFVRGLaepGL-GHS-HLIVT--------LN---------DK-----L 64
gi 499294229  16 ETLAALSPGQAEAVLALLDEAARVDGQPAVSEQGRLQLrggER-EGVRHLLLS--------AG---------DT-----L 72
gi 493821670  13 TTHLYNHRDLREQAMIMLKEVRAIDGVEALSEQFVRGLaepGL-GHTHYTVSV--------DG---------R------I 68
gi 500099622  13 IIAGALDTELLRDVKTLAAAAGESDGNPPFSEQTLVTLr--GA-DAGDHSVLSfvlyapdeDS---------DPataedL 80
gi 499237886   6 TSLASASAALRDRVDEILAAATREDGCAPLSESFLNGLrraDD-GHVHSCVMD--------SH---------DQ-----V 62
gi 499921431  15 TWQPTLSAADVDDIVSLLATAERADGTGPVSEDVRLTLrpdQRvGAARHLLAV--------SAtgveasgprRP-----I 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2C27_A        62 IGYLNLSPPRGAGGAMAELVVHPQSRRRGIGTAMARAALAKTA---GRNQFWAHGTLDPARATASALGLVGVRELIQMRR 138
gi 699204     62 IGYLNLSSPRDAGVAMAELVVHPRERRRGVGAAMVRAALAKTG---GRNRFWAHGTLASARATASVLGLVPVRELVQMQR 138
gi 500043021  65 VGYLNLTPPRDAQPQMAELVVHPRARRRGIGSALARAALAKTG---AANRFWAHGTLEPARATAAALGLSPVRELMQMRR 141
gi 499916427  64 VGYAQLQPGRGDHPAMAELAVDPAARGRGIGGRLVAEVLSEGG---PDARVWAHGNLPAAQAVAQRLGLIGARELLQLRR 140
gi 499881167  61 VGYLNLAPASDTAPPMAELVVHPDFRRRGTGAAMARAGLAEGG---THARIWAHGNLEAARATARTLGLQVVRELLQMRR 137
gi 499520491  62 AGYANLVPAHGDHPAMAEAAVAPARRGRGIGTALVREALAAGG---ADARVWAHGDRPAAKAVAARLGLRTARELWQMRR 138
gi 499324733  65 VGLAA------TDEETTELAVHPAHRRQGIGKALIDATPTS--------SIWAHGNTAGAQALASTLRMKKTRELLVMEI 130
gi 499294229  73 VGYAQLEDTDPVEAPAAELVVHPAHRGRGHGRALGTALLAATG---KRLRAWAHGGHSAARHLAQVLGLTLFRELRQMRR 149
gi 493821670  69 IGLGA------TDGETSELAVHPAHRRQGIGRELIDALPTDG--------VWAHGDLPPAQALASSLGLNKTRELLVMAV 134
gi 500099622  81 AGVAVVVE-NGDESGVLELAVHPSYRNQGVAGRLLDALQGKRGl--GGLSAWSHGNHEAAAELATRFGYGPVRELWKMRL 157
gi 499237886  63 VGVAA------RDGDSAEVVVDPAFRRQGYGSFLIRHVVSQGV---K--NVWAHGDGAGAKAVAKALQLEQTRQLLVMAV 131
gi 499921431  82 VGYAHLGGA--LDSRQAEIVVDPGHRGLGIGRALATALTEALGdppARLDVWAHGDLPPAAALAARLGFARTRVLFQLRR 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2C27_A       139 PLRD---IPEpTIPd--GVVIRTYAGTSD-----D-----AELLRVNNAAFAGHPEQGGWTAVQLAERRGEAWFDPDGLI 203
gi 699204    139 SLRT---IPDpMVPdqlGVWVRTYVGTVD-----D-----AELLRVNNAAFAGHPEQGGWTATQLAERRSEPWFDPAGLF 205
gi 500043021 142 SLRDl-pDSVpAVP---GVRIRTYAGLAD-----D-----AELLRVNNAAFAYHPEQGGWTDVELAERRAEPWFDPAGLF 207
gi 499916427 141 PLADa-eLPElVVPe--DISLRVYRGVED-----D-----PEVLRVNAAAFAWHPEQGSWTERELAERRAEAWFDPSGLF 207
gi 499881167 138 PLTD---LPPvTVAd--GVRLATYSGPGD-----D-----PELLRINNSAFAWHPEQGGWTDADIAERRAEAWFDPAGLF 202
gi 499520491 139 SLATp-qLPElVVPd--GIVLRTYAGPAD-----D-----AELLRVNNAAFDWHPEQGGWTQRDIAVRRAESWFDPAGLF 205
gi 499324733 131 SDRAlddSAAyKDPd--GITHSSLANAPV-----EksvaeAKWLQSNNEAFDWHPEQGGWTTHRLAQAQKADWYKDSDVL 203
gi 499294229 150 PLAGl-dLAEpKLPd--GVTVRAFVPGQD-----D-----AAWLAVNAAAFAHHPEQGSLTQRDLDDRKAEPWFDPAGFF 216
gi 493821670 135 EGDAlreAAVyDNPa--GITNSSLKTAPGtrdevE-----GKWLKANNEAFHWHPEQGGWDRNRLTRAQSATWFRETDVL 207
gi 500099622 158 MSSTs-aLPDaGLPd--GVSLRAFVPGQD-----E-----QAWLTANSAAFSHHPEQGSMTRADLEARKAEDWFDPEGFL 224
gi 499237886 132 EGDRlveSAQlQVPs--GFRVLALNEAYEsipdiE-----QQWLRVNNEAFEWHPEQGGWDSARLAQARDTQWFRESDVL 204
gi 499921431 160 PLGAvapLPEpQLPa--GVTVRAFVPGRD-----D-----EAWLAVNAAAFADHPEQGRWTLDDLALRRAEPWFDPRGFF 227
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2C27_A       204 LAFGD-SprerPG-RLLGFHWTKVHP---D---H---------PGLGEVYVLGVDPAAQRRGLGQMLTSIGIVSLARRlg 266
gi 699204    206 LAFGD-SssnqPG-KLLGFHWTKVHA---A---H---------PGLGEVYVLGVDPSAQGRGLGQMLTSIGIASLAQRlv 268
gi 500043021 208 LAFGD-DdsdrPG-RLLGFHWTKVHL---D---Q---------PGLGEVYVVGVDPCAQGRGLGQALTAVGIEWLARRlg 270
gi 499916427 208 MAFAA-S----DDqRLLGFHWTKVHPkqgD---E---------PAIGEVYVVAIGPDAQGRGLGRLLTLAGLHYLRDR-- 268
gi 499881167 203 MAFDD-A----SG-KLLGFHWTKVHG-----------------PDLGEVYVVGVDPAAQGRGLGATLTLTGLHHLAERls 259
gi 499520491 206 LATDTaA----PD-RVLGFHWTKVHA---De--Q---------PPVGEVYVVGIDPAAQGRGLGRLLTLAGLHHLRER-- 264
gi 499324733 204 FLWD-------GE-EIVGFHWVKQHS-----------------PELQEIYVVGLSSAYRGRGLGDPLVRLGLHHMRAH-- 256
gi 499294229 217 LAERD-------G-ELIGFHWTKVHA---Q---E----------GIGEVYVLGVRPGAQGGGLGKALTTIGLRHLEAQ-- 270
gi 493821670 208 FLWD-------GD-ELVGFHWVKKHS---D---E-----------LQEIYVVGLAEAYRGKGLGDPLVRLGLRHMVNG-- 260
gi 500099622 225 LAVN--A----EG-ELLGFHWTKVHP---RqgpH---------PAIGEVYVVGVTPEAQGLGLGKALTVAGIKHLQDQ-- 283
gi 499237886 205 FLIDT-A----KR-TVAGFHWTKRHG---Dl-aE---------GADGEVYVVGLGSAYRRRGLGDLLIRMGLHHLEYE-- 263
gi 499921431 228 VAERD-------G-QLVGFHWTKIHE---V---DetpppgtrpGPIGEVYVVGVLPGAGGAGLGRALTLIGLRHLQAE-- 291
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|..
2C27_A       267 grktldpaVEPAVLLYVESDNVAAVRTYQSLGFTTYSVDTAY 308
gi 699204    269 g-----psAEPTVMLYVESDNVAAARTYERLGFTTYSVDTAY 305
gi 500043021 271 ag---dsaADPTVMLYVEADNVAAVRTYQRLGFTTYSVDTAY 309
gi 499916427 269 --------GLGAVLLYVEGDNESALHTYDRLGFERFHTDVAY 302
gi 499881167 260 ------nsPQPTVMLYVEADNGAAVKTYRRLGFDVSSvdaay 295
gi 499520491 265 --------GLGGVLLYTEADNTAAVNTYTKLGFAPAHVDVAY 298
gi 499324733 257 --------GARKVILYVEAGNTPAVAAYEKLGFTVAESHVVY 290
gi 499294229 271 --------GLPTAMLYVDADNKAAVSVYERLGFATHETDLMY 304
gi 493821670 261 --------GARRVILYVEADNDSAVAAYEKLGFTVAERHVVY 294
gi 500099622 284 --------GLHAVMLYVDADNEAAVALYQKLGFVRWDTDVMY 317
gi 499237886 264 --------HARRVILYVEGDNESARRAYDALGFHVVESHVTY 297
gi 499921431 292 --------GLAAVLLYVDEDNERAVRMYTGLDFTVHTRDVSY 325
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap