3C4Q


Conserved Protein Domain Family
mycothiol_MshA

?
TIGR03449: mycothiol_MshA 
Click on image for an interactive view with Cn3D
D-inositol-3-phosphate glycosyltransferase
Members of this protein family, found exclusively in the Actinobacteria, are MshA, the glycosyltransferase of mycothiol biosynthesis. Mycothiol replaces glutathione in these species.
Statistics
?
PSSM-Id: 132490
View PSSM: TIGR03449
Aligned: 11 rows
Threshold Bit Score: 661.819
Threshold Setting Gi: 86739171
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3C4Q_A         3 VAMISMHTSPLQQPGTGDSGGMNVYILSTATELAKQGIEVDIYTRATRPSQGEIVRVAENLRVINIAAGPYEGLSKEELP 82
gi 499584768   5 VAMISMHTSPLQQPGTGDSGGMNVYILSTATELAKQGIEVDIYTRATRPSQGEIVRVAENLRVINIAAGPYEGLSKEELP 84
gi 493822844   3 VAMISMHTSPLQQPGVGDSGGMNVYILSTGTELARQGVEVDIFTRATRPSQGEVVQVAPNLRVINIVAGPYEGLAKEELS 82
gi 491394078  13 VAVLSVHTSPLAQPGTGDAGGMNVYVLQSAIQMARRGVEVEIFTRATSSADAPVQEAAPGVLVRNVVAGPFEGLDKQDLP 92
gi 491434363   3 VAMISMHTSPLEQPGTGDAGGMNVYVKNIAEQLERRGVIVDVFTRATRPLQGEVVNVRPGLRVINCVAGPYEGLSKEELP 82
gi 499525086  15 IAVLSVHTSPLAQPGTGDAGGMNVYVLRTAVELAQRGIEVEIFTRATASHIPPVQEAAPGVLVRNVVAGPFEGLDKQDLP 94
gi 499236723   6 IAMISIHTSPLQQPGSGDAGGMNVYIISIARELARRGVDVDIYTRATRPSQGDVVEVESGLRVINIVAGPYEGLSKEELP 85
gi 510815824   6 IAAISLHTSPLDQPGTGDAGGMNVYIVEVAKRLAERGIAVDIFTRATSFEQPPEVELAPGVTVRNIAAGPYGTLDKTALI 85
gi 490014710  44 VALLAVHTSPLAQPGTGDAGGMNVYMLQSALHLARRGIEVEIFTRATASADPPVVRVAPGVLVRNVVAGPFEGLDKYDLP 123
gi 499754185  24 VAMLSMHTSPMEQPGTGDAGGLNVYVVELSRQLAALGVEVEVFTRAVSSKLPTSAELLPGVTVRHVDAGPFEEIHREDLP 103
gi 499294177  47 VAMLSVHTSPLHQPGTGDAGGMNVYIVELAQRLAAINIEVEIFTRATTAALRPTVELSPGVLVRHVDAGPYEGLAKEDLP 126
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3C4Q_A        83 TQLAAFTGGML-SFTRREKVTYDLIHSHYWLSGQVGWLLRDLWRIPLIHTAHTLAAVKNSYRDDSDTPESEARRICEQQL 161
gi 499584768  85 TQLAAFTGGML-SFTRREKVTYDLIHSHYWLSGQVGWLLRDLWRIPLIHTAHTLAAVKNSYRDDSDTPESEARRICEQQL 163
gi 493822844  83 TQLAAFAGGVL-EFTRRGGIEYDLIHSHYWLSGQVGWLMRDLWRIPLVHTAHTLAAVKNSYRADEDTPESEARRICEQQL 161
gi 491394078  93 TQLCAFVAGVLrEEARHEPGYYNLVHSHYWLSGQVGWLARDRWGVPLVHTAHTLAAVKNLSLADGDTPEPAARQIGEQQV 172
gi 491434363  83 TQLAAFTGSIL-AFCREEGVSYDLIHSHYWLSGQVGWLLRDLWQVPWVHTAHTLAAVKNNSLADGDSREPESRRICEQQI 161
gi 499525086  95 TQLCPFTAEVLrQEARQLPGYYDLVHSHYWLSGQVGWLTRDRWRVPLVHTAHTLAAVKNAALAEGDAPEPVSREIGEKQI 174
gi 499236723  86 TQLAAFAGGVV-QFAKCHHMRYDVIHSHYWLSGQVGWLLRDLWNIPLVHTAHTLAAVKNAHRSAGDTEESEARRICEQQL 164
gi 510815824  86 NYLCPFVHGMLrAEAEHLGGSYDLVHTHYWLSGQAGWPVAREWGVPLVHSMHTMARVKNMSLAEGDTPEPEERVRGEDAL 165
gi 490014710 124 TQLCAFAAGVLrAEAVHEPGYYDIVHSHYWLSGQVGWLARDRWAVPLVHTAHTLAAVKNAALADGDGPEPPLRTVGEQQV 203
gi 499754185 104 AWLCAFTAALLrAEAGHEPGWFDVIHSHYWLSGQVGLAVAQRWGIPLVHTSHTLAKIKNGALAVGDRPEPPGRLLGEQEV 183
gi 499294177 127 AQLCAFTHGVMqAWAGHRPGYYDLVHSHYWLSGHVGWLAAQRWGTPLVHAMHTMAKVKNAALAEGDTPEPAARVIGEMQI 206
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3C4Q_A       162 VDNADVLAVNTQEEMQDLMHHYDADPDRISVVSPGADVELYSPGnD-RATERSRreLGIPLHTKVVAFVGRLQPFKGPQV 240
gi 499584768 164 VDNADVLAVNTQEEMQDLMHHYDADPDRISVVSPGADVELYSPGnD-RATERSRreLGIPLHTKVVAFVGRLQPFKGPQV 242
gi 493822844 162 VDNADVLAVNTQEELADLVHHYDADPDRISVVSPGADIALYTPGnD-RATERSRreLGVPLHAKVVAFVGRLQPFKGPQV 240
gi 491394078 173 VAESDRLVANTTEESDQLVRHYGADPNRIDVVAPGADLTRYRPG-D-RAAARAK--LGLDPRETVVTFVGRIQPLKAPDV 248
gi 491434363 162 VDNADLLIVNTDQEVQDLIEGYDATTCAIRVVPPGADVDRFTPGsD-RATERSRreLGIPFRTKVIGFVGRLQRLKGPQV 240
gi 499525086 175 IAEADRMVANTAEEARQLVELYGADRDRIDVVPPGADLTRYRPG-D-RAAARAE--LGLAPGEPIVAFVGRIQPLKAPDV 250
gi 499236723 165 VDNADILVVNTPEETNDLVRHYDANPDSVAVIAPGANVELFTPG-TqRNTEQSRrcLGIPLHTKVMAFVGRLQQFKGPEV 243
gi 510815824 166 VALADRLIANTDDEAAQLINYYGASPSRVSTVFPGVDLTTFTPG-S-RAESLRR--LGLPEDTILLLFVGRVQRLKAPDV 241
gi 490014710 204 VDEADRLIVNTDDEARQVISLHGADPARIDVVHPGVDLDVFRPG-D-RRAARAA--LGLPVDERVVAFVGRIQPLKAPDI 279
gi 499754185 184 IGGATRLLASTPDEYRHLIDLYDAASDRVDVVAPGVDLEVFRPG-D-MAQSRAR--VGVDPADDLLLFVGRIQPLKAPDL 259
gi 499294177 207 VAAADRLIANTSEEADELVRHYEAERGKVAVVHPGVNLDRFRPA-DgRAAARAR--LGLPQDALIPLFAGRIQPLKAPDV 283
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3C4Q_A       241 LIKAVAALFDRDPD--R--NLRVIICGGPSGPN-ATPDTYRHMAEELGVEKRIRFLDPRPPSELVAVYRAADIVAVPSFN 315
gi 499584768 243 LIKAVAALFDRDPD--R--NLRVIICGGPSGPN-ATPDTYRHMAEELGVEKRIRFLDPRPPSELVAVYRAADIVAVPSFN 317
gi 493822844 241 LIHAVAELLERDPQ--R--NLRVLICGGPSGPS-ATPETYRNLAVELGVDKRIRFLDPRPPEELVAVYRAADIIAVPSYN 315
gi 491394078 249 LLRAAAELIARDPE--S--TLRVLVVGGPSGSGlARPDALIELASSLGIAARVTFLPPQAPDRLVDVYRASDLVAVPSYS 324
gi 491434363 241 LLRAVAELLDRHPQ--Q--QLAVVICGGSSGAGgNELERLQLLAEELGISRCVRFLAPRPPEELVGVYRAADIVAVPSYN 316
gi 499525086 251 LVRAAAELLRRDPG--R--ALRVLIVGGPSGSGlQRPDALIELAAELGISERVTFLPPQPPERLVQVYRAADLVAVPSYS 326
gi 499236723 244 LLRAVAEMLERDPD--R--DMRVIMCGGPSGAA-ATVEHYIELTRSLGIAHRVRFLDPRPPEELVSVYQAADVVAVPSYN 318
gi 510815824 242 LLRAAARLLELNPSlrD--RLVVAVVGGQSGTGyREPWLLSDLADSLGIADLVRLEPPCPRAELVHYYRAATVTVVPSHS 319
gi 490014710 280 VLRAAAKL----PG------VRIIVAGGPSGSGlASPDGLVRLADELGISARVTFLPPQSHTDLATLFRAADLVAVPSYS 349
gi 499754185 260 LLRAAAELLRRDPA--RrsRLTVAVVGGPSGSGlEQPDALVKLAAYLGISDRVRFQPPAPQQELVHWYRAATAVVVPSHS 337
gi 499294177 284 LLRAVAVLLDERPElrS--NLVVPVVGGPSGSGlAKPEGLQKLAARLGIADVVRFRPPVGQEQLADWFRAASVLVMPSYN 361
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3C4Q_A       316 ESFGLVAMEAQASGTPVIAARVGGLPIAVAEGETGLLVDGHSPHAWADALATLLD--DDETRIRMGEDAVEHARTFSWAA 393
gi 499584768 318 ESFGLVAMEAQASGTPVIAARVGGLPIAVAEGETGLLVDGHSPHAWADALATLLD--DDETRIRMGEDAVEHARTFSWAA 395
gi 493822844 316 ESFGLVAMEAQATGTPVVAARVGGLPVAVAEGETGLLVDGHDPALWADTLATLLD--DDETRIRMGQDAVEHARNFSWAA 393
gi 491394078 325 ESFGLVAIEAQACGTPVIAANVGGLGVAVRNGETGLLVDGHRTEDWATALQSLVS--EPGRLAALAAEAPRHAENFSWEH 402
gi 491434363 317 ESFGLVALEAQACGTPVVATRTGGLPIAVDGGKSGLLVDGHDPSDWADALGKLVL--DDDLRIAMGEYAPSHAAKFSWQA 394
gi 499525086 327 ESFGLVAIEAQASGTPVLAADVGGLSTAVRDGATGLLVRGHETADWADALGALLG--DRDRLRRMGLRAVAHAAGFSWAH 404
gi 499236723 319 ESFGLVAMEAQASGTPVVAARVGGLPIAVVDGETGVLVDGHDPIMWADALEQLLD--DDPTRQQMGVAAVEHAANFTWAA 396
gi 510815824 320 ESFGLVAVESQACGTPVVAARVGGLPTAVRDGVSGVLIDGHDPHDYANVLHRMIT--EPRWRERMGAAGIHHASGLSWES 397
gi 490014710 350 ESFGLVAVEAQACGTPVVAAAVGGLPVAVRDGITGTLVSGHEVGQWADAIDHLLRlcAGPRGRVMSRAAARHAATFSWEN 429
gi 499754185 338 ESFGLVALEAQACGTPVVAAAVGGLRTAVADGVSGLLVSGRTPAVYADALDRLLR--QPRWRARLSAGAVAWAGGFGWSA 415
gi 499294177 362 ESFGLVAIEAQAAGTPVLAASVGGLPVAVADGRTGFLVQGHDPAAYARVLRDFAD--DPALSARMGRAAARHAECFGWDT 439
                        410
                 ....*....|....*
3C4Q_A       394 TAAQLSSLYNDAIAN 408
gi 499584768 396 TAAQLSSLYNDAIAN 410
gi 493822844 394 TATQLSSLYSEATTA 408
gi 491394078 403 TADGLLESYRMATVN 417
gi 491434363 395 SAEALHKLYEELPPA 409
gi 499525086 405 TAEGLLESYSAALWE 419
gi 499236723 397 AAEKLESVYGDAAMl 411
gi 510815824 398 TVDGLLAAYRDALHQ 412
gi 490014710 430 TTDALLASYRRAIGE 444
gi 499754185 416 TAHGVLRSYRHALSP 430
gi 499294177 440 AASATADVYTAAMQA 454
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap