Conserved Protein Domain Family
mycoS_dep_FDH

?
TIGR03451: mycoS_dep_FDH 
S-(hydroxymethyl)mycothiol dehydrogenase
Members of this protein family are mycothiol-dependent formaldehyde dehydrogenase (EC 1.2.1.66). This protein is found, so far, only in the Actinobacteria (Mycobacterium sp., Streptomyces sp., Corynebacterium sp., and related species), where mycothione replaces glutathione. [Cellular processes, Detoxification]
Statistics
?
PSSM-Id: 132492
View PSSM: TIGR03451
Aligned: 8 rows
Threshold Bit Score: 614.888
Threshold Setting Gi: 86740155
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3915692     3 TVRGVIARSKGAPVELTDIVIPDPGPSEVTALIATCAVCHTDLTYREGGINDEFPFLLGHEAAGTVESVGEGVDSVQPGD 82
gi 532539104   7 TVRGVIARQKGEPVELVNIVVPDPGPGEAVVDVTACGVCHTDLTYREGGINDEYPFLLGHEAAGIIEAVGPGVTAVEPGD 86
gi 499337618   4 EVRGVIAPGKDEPVRIETIVVPDPGPGEAVVKIQACGVCHTDLHYKQGGINDEFPFLLGHEAAGVVESVGAGVTDVAPGD 83
gi 499297092   6 EVRAVVAVKKGAPVEVQTIVVPDPGPGEVLVAVQACGVCHTDLHYREGAITDDFPFLLGHEAAGTVEAVGAGVTDLAPGD 85
gi 493822687   4 TVPGIIARSKGAPVEKVNVVVPDPGANDVIVDIQACGVCHTDLAYRDGDISDEFPYLLGHEAAGVVSVVGENVTHVEVGD 83
gi 500098991  27 AVKGVVVRSKGAPATLETILVPEPGPGEALVDILTSGVCHTDLHYKLGGISDDFPFLLGHEATGVVSAVGPDVTDVAPGD 106
gi 499592534   4 TVKAVISRAKNEPVELTDIVIPEPGENDVIVRIQACGVCHTDLAYRDGGIADNYPFLLGHEAAGVVEQVGDRVTHVEVGD 83
gi 499755157   5 TVEAVVAREKGAAVSLEQIVVPDPGPGEARVRVRACGVCHTDLHYREGAINDDYPFLLGHEAAGTVESVGEGVVGLAPGD 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3915692    83 YVVLNWRAVCGQCRACKRGRPQYCFSTFNATQKMTLTD-GTELTPALGIGAFADKTLVHAGQCTKVDPAADPAVAGLLGC 161
gi 532539104  87 FVILNWRAVCGQCRACKRGRPRYCFDTFNAEQKMTLTD-GTELTAALGIGAFADKTLVHSGQCTKVDPAADPAVAGLLGC 165
gi 499337618  84 FVILNWRAVCGKCRACRRGRPWYCFDTHNAEQRMTLAStGQELSPALGIGAFAEKTLVAAGQCTKVDPAVPAEVAGLLGC 163
gi 499297092  86 YVVLAWRAPCGSCRSCRRGRPWYCFDSRNATQPMTLLD-GTPLSNALGIGAFAEKTLVAAGQAVKIDPAARPEAAGLIGC 164
gi 493822687  84 FVVLNWRAVCGECRACKKGEPKYCFNTHNASKKMTLED-GTELSPALGIGAFIEKTLVHEGQCTKVNPDEDPAAAGLLGC 162
gi 500098991 107 RVVLNWRAVCGNCRACNRGQAQYCFNTHNATQKMTLED-GTELSPALGIGAFIEKTLVAAGQCTKVDPDADAAAVGLLGC 185
gi 499592534  84 YVVLNWRAVCGQCRACKKGEPKYCFDTHNASKKMTLTD-GTELEAALGIGAFAEKTLVHEGQCTKVDSEADPAVAGLLGC 162
gi 499755157  85 YVVLAWRAPCGTCRACRRGMAWYCFDSRNARNPMTLAD-GTPLAPALGIGAFTPLTLVAAGQCVPVDPAARPEAAGLIGC 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3915692   162 GVMAGLGAAVNTGAVSRGDSVAVIGCGAVGDAVIAGARLAGANKIIAVDRDAKKLEWAT-ELGATHTVNATE-------T 233
gi 532539104 166 GVMAGLGAAINTGGVTRDDTVAVIGCGGVGDAAIAGAALVGAKRIIAVDTDDTKLDWAR-TFGATHTVNARE-------V 237
gi 499337618 164 GVMAGIGAAINTGNVGRGDTVAVIGCGGVGDAAIAGSYLAGASKVIAVDIDDRKLETAR-TMGATHTVNSRG-------T 235
gi 499297092 165 GVMAGYGAAVNTGKVGRGDTVAVIGCGGVGNAAIAGACLNGAMKVIAVDIDDKKLDQAE-KFGATHTVNSRG-------T 236
gi 493822687 163 GIMAGLGAAVNTADIQLGESVAVFGLGGVGMAAVAGAKLAGASKIIAVDIDERKLEWAR-EFGATDVINSSGlsgegeeS 241
gi 500098991 186 GVMAGLGAALNTGGVKRGDSVAVIGCGGVGVAAIAGAALAGATTIIAVDIDAKKLERAK-ELGATHTVDSSA-------G 257
gi 499592534 163 GVMAGLGAAVNTGEVKRGESIAVIGVGGVGMAAIAGAAVAGATKIIAIDISDAKLARAKeEFGATHTINSSGls----dD 238
gi 499755157 164 GVMAGFGAAVNTGRVTRGETVAVIGCGGVGGAAIAGASIAGARKIIAVDVDDRKLTWAR-RFGATDVVNATA-------D 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3915692   234 DVVEAVQALTGGFGADVVIDAVGRPETWKQAFYARDLAGTVVLVGVPTPDMRLEMPLLDFFSRGGALKSSWYGDCLPERD 313
gi 532539104 238 DVVQAIGGLTDGFGADVVIDAVGRPETYQQAFYARDLAGTVVLVGVPTPDMRLDMPLVDFFSHGGALKSSWYGDCLPESD 317
gi 499337618 236 DPVEAIRELTGGFGADVVIEAVGRPETYRQAFYARDLAGTVVLVGVPTPEMKLELPLLDVFGRGGSLKSSWYGDCLPSRD 315
gi 499297092 237 DPVEAVRALTDGFGVDIAIDAVGRPETYKQAFYMRDHAGTLVQVGVPDPEMKIDLPLIDLFSRGGALKSSWYGDCLPSRD 316
gi 493822687 242 EVVAKIRELTGGFGTDVTIDAVGIMPTWQQAFYSRDHAGRMVMVGVPNLTSHIDIPAIDFYGRGGSLRPAWYGDCLPERD 321
gi 500098991 258 DPVEEIRALTGGFGADVVIDAVGRPETYKQAFYARDLAGTVVLVGVPTPEMTLELPLLDVFGRGGSLKSSWYGDCLPSRD 337
gi 499592534 239 ELVEKVQEINGGFGVDVAVDAVGVPQTYKQAFYVRDLAGRVVLVGVPTPDMTLELPFLDVFSHGGALKSSWYGDCLPERD 318
gi 499755157 236 DPVAAIRALTDGFGADVVIDAVGRPETYRQAFDARDLAGRLVLVGVPDPTMTVELPLAEVFGRGGHLSSSWYGDSLPSRD 315
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*..
gi 3915692   314 FPVLIDLHLQGRLPLDKFVTERISLDDVEKAFHTMHAGEVLRSVVVW 360
gi 532539104 318 FPTLIDLYLQGRLPLQRFVSERIGLEDVEEAFHKMHGGKVLRSVVML 364
gi 499337618 316 FPMLVDLHLQGRLDLGKFVTETIRLDEVEQAFDRMHAGDVLRSVVVL 362
gi 499297092 317 FPFLIDQYLYGLLDLNAFVSETISLEQVEEAFAKMHRGEVLRSVVVL 363
gi 493822687 322 FPAYVELHLQGRFPLDKFVSERIGLDDVEEAFNTMKAGDVLRSVVEL 368
gi 500098991 338 FPMLVDLYKQGKLDLDAFVTERITINQVEDAFDKMHQGAVLRSVVEL 384
gi 499592534 319 FPMYVDLYQEGRFPLDRFVDDRISIDGVEDAFEKMKQGKVLRSVVEF 365
gi 499755157 316 FPILIDLYRRGRLDLDAFVTETIGIGDVEEAFTRMQRGDVLRSVVIL 362
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap