Conserved Protein Domain Family
sulphoacet_xsc

?
TIGR03457: sulphoacet_xsc 
sulfoacetaldehyde acetyltransferase
Members of this protein family are sulfoacetaldehyde acetyltransferase, an enzyme of taurine utilization. Taurine, or 2-aminoethanesulfonate, can be used by bacteria as a source of carbon, nitrogen, and sulfur. [Central intermediary metabolism, Other]
Statistics
?
PSSM-Id: 132497
View PSSM: TIGR03457
Aligned: 4 rows
Threshold Bit Score: 1017.87
Threshold Setting Gi: 39932465
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48093481  18 KMTPSEAFVETMVANGVTDMFGIMGSAFMDAMDIFAPAGIRLVPVVHEQGAGHMADGYARVSGRHGMVIGQNGPGISNCV 97
gi 39932462  14 EMTPSEAFVETMVANGVTEIFGIMGSAFMDAMDIFAPAGIKLIPVVHEQGAAHMADGFARVSGRTGVVIGQNGPGISNCV 93
gi 39932465   5 KMTPSEAMTEVLVNEGVTHVTGILGSAFMDMLDLWPTAGIEFIAVRHEQTAGHMQDAYCRITGKASVCIGQNGPGVTNLV 84
gi 39932464   2 KMTTEEAFVKVLQMHGIEHAFGIIGSAMMPVSDLFPKAGIRFWDCAHETNAGMMADGFSRATGTMSMAIGQNGPGVTGFI 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48093481  98 TAIAAAFWAHSPVVIVTPEAGTMGTGLGGFQEANQLPMFQEFTKYQGHVNNPKRMAEFTGRCFDRAMSEMGPTQLNIPRD 177
gi 39932462  94 TAIAAAYWAHTPVVIVTPEAGTTGIGLGGFQEARQLPMFQEFTKYQGHVTHPARMAEYTARCFARARDEMGPAQLNIPRD 173
gi 39932465  85 TCVAAANQAHTPMVVLGPSAGTPTVGWDGFQECDQVSIFRSITKQVLQVPHPSRAGDVLRTAFRIAYAERGPVYVDIPRN 164
gi 39932464  82 TAMKTAYWNHTPLLMVTPQAANKTIGQGGFQEVDQMAMFEEMVCYQEEVRDPSRIPEVLNRVIEKAWRGCAPAQINIPRD 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48093481 178 YFYGEIETEIPQPTRLD----RGPGGETSLNEAAELLAQAEFPVIVSGGGVVMADGVEECKALAERLGAPVVNSYLHNDS 253
gi 39932462 174 YFYGKIKCEIPLPQPLD----RGPGGAQSLDAAARLLAEAKFPVIISGGGVVMGDAVEECKALAERLGAPVVNSYLHNDS 249
gi 39932465 165 YFYGEVYEEILRPDQYRamnvRGAGDATELARATEILAAAKNPVIISGRGVVDADAFAEVKEIAHMLTAPVAMSYLHNDT 244
gi 39932464 162 FWTQVIDVDLPRIVRFE----RPAGGPAAIAQAARLLSEAKFPVILNGAGVVIGNAIQESMALAEKLDAPVCCGYQHNDA 237
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48093481 254 FPASHPLWTGPLGYQGSKAAMKLISQADVVLALGTRLGPFGTLPQHGMDYWPKNAKIIQIDADHKMLGLVKKISVGICGD 333
gi 39932462 250 FPASHPLWCGPLGYQGSKAAMKLLADADVVLALGTRLGPFGTLPQHGLDYWPKNARIIQVDADSKMLGLVKKITVGVCGD 329
gi 39932465 245 YPADDELWVGPIGYMGAKSAMYSLQDADVILAIGSRLSVFGTLPQYDINYFPENAKIIQIEVNPKQIGRRHPVTVPIIGD 324
gi 39932464 238 FPGSHRLSVGPLGYNGSKAAMELISKADVVLALGTRLNPFSTLPGYGIDYWPKDAAIIQVDINADRIGLTKKVTVGICGD 317
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48093481 334 AKAAAVALTERLEGKalVCDAN-RAARGEKIDAEKAAWEKELDEWTHERDPFSLDMIAEQEGEEGNWLHPRQVLRELEKA 412
gi 39932462 330 AKASAAEISRRIDGMklACDAN-KAERAARIQAEKDAWEQELTDWTHERDPFSLDMIEEQSKEEGNWLHPRQVLRELEKA 408
gi 39932465 325 AKLATAELIKLLKAK---GDVKpNAERLAKIQERRNDWFKEIEEMA---------------MMPGNPINPRRVLFEVAKL 386
gi 39932464 318 AKQVAQQILQQLAPA--AGDAS-REERKALVHQTRSAWLQQLSSMDHEDDDPGTEWNVGARQREPDRMSPRQVWRAIQAV 394
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48093481 413 MPEDVMVSTDIGNINSVANSYLRFEKPRSFLAPMSFGNCGYALPTVIGAKAAAPERPAIAYAGDGAWGMSLGEIMTAVRH 492
gi 39932462 409 MPEDVMVSTDIGNINSVANSYLRFEKPRSFFAAMSWGNCGYAFPTIIGAKVAAPHRPAVSYAGDGAWGMSMSEIMTCVRH 488
gi 39932465 387 MPEDAILTTDIGNVASTANSYFKFTKPKKHIAALTFGNTGFAYQAGLGAQMAEPDSPVVAIVGDGAWGQSLHEISTAVQY 466
gi 39932464 395 LPKEAIISTDIGNNCAIGNAYPSFEQGRKYLAPGMFGPCGYGFPSIVGAKIGCPDVPVVGFAGDGAFGISMNEMTSIGRE 474
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48093481 493 DIP-VTAVVFHNRQWGAEKKNQVDFYNRRFVAGELESE-SFAGIAQAMGAEGIVVDKLEEVGPALQRAVAAQmNEGKTTV 570
gi 39932462 489 DIP-VTAVVFHNRQWGAEKKNQVDFYNRRFVAGELESE-SFAGIARAMGAEGVVVDRIEDVGPALKKAIDAQmNDRKTTV 566
gi 39932465 467 KLP-VIACVFRNMAWCAEKKNQIDFYNNRFVGTEIPNPiSFIPAAEAFGAKGIRVEKPEDIADAFKQGLAWR-AEGHPVV 544
gi 39932464 475 GWPaITMVIFRNYQWGAEKRNTTLWYDNNFVGTELNPNlSYAKVADGCGLKGVTVDTPAALTEALAKAIEDQ-AKGITTF 553
                       570       580       590
                ....*....|....*....|....*....|.
gi 48093481 571 IEIMCTRE-LGDPFRRDALSKPVRL--LDKY 598
gi 39932462 567 IEIMCTRE-LGDPFRRDALSKPVRL--LEKY 594
gi 39932465 545 LEFVVDGTiLAPPFRKDALALPTRY--LPKY 573
gi 39932464 554 VEVVLNQE-LGEPFRRDAMKKPVAVagIDRA 583
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap