Conserved Protein Domain Family
HpnJ

?
TIGR03471: HpnJ 
hopanoid biosynthesis associated radical SAM protein HpnJ
The sequences represented by this model are members of the radical SAM superfamily of enzymes (pfam04055). These enzymes utilize an iron-sulfur redox cluster and S-adenosylmethionine to carry out diverse radical mediated reactions. The member of this clade from Acidithiobacillus ferrooxidans ATCC 23270 (AFE_0975) is found in the same locus as squalene-hopene cyclase (SHC, TIGR01507) and other genes associated with the biosynthesis of hopanoid natural products. Similarly, in Ralstonia eutropha JMP134 (Reut_B4901) this gene is adjacent to HpnAB, IspH and HpnH (TIGR03470), although SHC itself is elsewhere in the genome. Notably, this gene (here named HpnJ) and three others form a conserved set (HpnIJKL) which occur in a subset of all genomes containing the SHC enzyme. This relationship was discerned using the method of partial phylogenetic profiling. This group includes Zymomonas mobilis, the organism where the initial hopanoid biosynthesis locus was described consisting of the genes HpnA-E and SHC (HpnF). Continuing past SHC are found a phosphorylase enzyme (ZMO0873, i.e. HpnG, TIGR03468) and another radical SAM enzyme (ZMO0874), HpnH. Although discontinuous in Z. mobilis, we continue the gene symbol sequence with HpnIJKL. One of the well-described hopanoid intermediates is bacteriohopanetetrol. In the conversion from hopene several reactions must occur in the side chain for which a radical mechanism might be reasonable. These include the four (presumably anaerobic) hydroxylations and a methyl shift.
Statistics
?
PSSM-Id: 132511
View PSSM: TIGR03471
Aligned: 8 rows
Threshold Bit Score: 895.999
Threshold Setting Gi: 83312582
Created: 9-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 501530511   3 MKTLFLQAPSFEGFDGGAGSRYQAKREIRSFWFPTWLAQPAAMIPGSRLLDAPPADVSVEETLQVAAGYDLCIIHTSTPS 82
gi 499620281   2 KKTLFLQAPSFDGFDGGAGSRYQAKREIKSFWYPTWLAQPAALVPGSRVLDAPADELTPQQTLDIAVDYDLVIVHTSTPS 81
gi 499933438   2 KKTLFLNPPSFDGFDGGAGARYQAKREITSFWYPTWLAQPAALVPGSKLVDAPAHYQTVEDVLKIAKDYELVIMHTSTPS 81
gi 499842387   3 LKTLFLNPPSFENYDGGASSRWPATREIESYWYPVWLAYPAGMLEGSRLLDAPPHHVSFDETIQISKDYDFVVLFTSTPG 82
gi 499560043   2 MRTLFLQAPSFDGFDGGAGSRYQARREIKSFWYPTWLAQPAALIKDSKLIDAPPHGTKLPEVLAIAPDYDLAILHTSVPS 81
gi 500008409   1 MRTLFLNPPSFEGFDGGASSRWPASREIESYWYPVWLCYPAGMLPDSRVVDAPPHKISIEQTVEMGKDFELLVLYTSTPG 80
gi 490647489   1 MKPLFLNPPTYEDFDGGAGARYQASREVTSFWYPTWLCFPAGMIDGSRVVDAPVQRFTIDDCLAIARDFDMVVMYTSTPT 80
gi 499705109   2 KKSLFLNPPSFEGYDGGAGARFQAKREIKSNWYPTWLAQPAAMVPGSKLVDAPASGKTLDDCLKLAKDYELLVIYAGAAT 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 501530511  83 FPSDVRMAEVLKEHYPKLLIGMVGAKVAVEPEESLQQAA-AaVDFVAREEFDYTLKEIAEGRPLSEVDGITYRSSNGQII 161
gi 499620281  82 FPTDAKFAEELKKRKPGVMIGMVGAKPAVDPGGTLGASG-A-IDFVCREEFDYTCQDVAAGKPLKDILGLSYRLPDGSLE 159
gi 499933438  82 LPNDIKCAEAIKNQNPETKIGFVGAHVAVLPEKTLKDHP-I-IDFVCRNEFDYTCKELSQGKPFAKIKGLSYYDTQGNIH 159
gi 499842387  83 FPGDLKIAKAMKTANPNVKIAFVGPHVTTLPERSLAEGP-E-IDFIVRREFDYAVVEYANGKPLNEITGVSYRGADGKVV 160
gi 499560043  82 FASDVKTVAALKKVNPAMKIGFIGAKVAVEADKSLKDAKgI-VDFVARNEFDFTIKDVADGKDWSEILGLSYINDKGEIV 160
gi 500008409  81 FNIDVKMATMMKDVNPKLKVAFVGPPVTTEPDKTLIGTK-A-IDFVVRREFDHQIVDYAKGKPLEELPGVSFR-KNGHIV 157
gi 490647489  81 LALDIATARRVKEQKPATVTVLTGPHVSVLPEETLRQGEgV-IDIVCRGEFDYTTKELCEGREWAKVDGISFW-KDGKIH 158
gi 499705109  82 YASECKVAEAFKAANPNIMIGMVGAHVATVPEPSLLASD-A-IDFVARHEFDYTIVEVAEGKPFAEIDGLTFRGEDGKPV 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 501530511 162 HNPDRAMIEDMDALPFVSEVYKRDLHIEDYFIGYLKHPYISFYTGRGCRSQCTFCLWPQTVGGHRYRTRSAASVIEEVRY 241
gi 499620281 160 HNGQRPMIENMDELPFVAPVYKRDLKIENYFIGYLKHPYVSIYTGRGCRSRCTFCLWPQTVGGHRYRTRSAESVIAEVKW 239
gi 499933438 160 HTPERELIHDWDAMPSVFPVYAEHLNIRNYLIGYLLNPYISLYTGRGCPAKCTFCLWPQTIGGHQYRAKSPEAVGREMAE 239
gi 499842387 161 HNPDRPPVSNLDEMPDVIDVYKRDLDVKRYNVPFLLHPYIALYTTRGCPAQCTFCLWPQTLSGHPWRKRSSDAVASEMKR 240
gi 499560043 161 HNADRPLLQNMDELPFVTPIYKRDLEIEKYFIGYLKHPYISIYTGRGCKSHCSFCLWPQTVGGHKYRTRSVEHVIEEIKY 240
gi 500008409 158 NNPEGPAIEDLDALPWVTKVYKRDLDITRYNVPFLLNPFVSLYTSRGCPALCTFCLWPQTHSGHRWRLRSSDDVANEVRY 237
gi 490647489 159 HTPDRPPIQDLDALPFVAPVYKRDLPIAEYVIPHFKNPYVSIYSSRGCPSKCIYCLWPQTFSGRAMRTRSPQNVYEEVKW 238
gi 499705109 160 HTKDRAMIHDMDALPFVGPVYRRDLNPDDYFIGYIRHPYMAFYTGRGCKSKCSFCLWPQTIGGRVYRARSAKSVIEEVTL 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 501530511 242 IQKNF-PQVKEIFFDDDTFTDDRPRAEEIARGLGKLGVTWSCNAKANVPYDTLKVLHENGLRLLLVGYESGDQQILNNIK 320
gi 499620281 240 IKENM-PEVKEIMFDDDTFTDFKPRVEEIARGLGKLGVTWSCNAKANVPYSTLKIMKENGLRLLLVGYESGDDQILLNIK 318
gi 499933438 240 AKAIWgSSVREYFFDDDTFTIDKKRAIAISEHLQRLKLTWSCNARGNLDYNTLKELKKNGLRLLLVGFESGNQKILDGVN 319
gi 499842387 241 AMELF-PWVREFFFDDDTFNIQKARTIELCEKLKPLGMTWSCTSRVTTDYETLKAMKEAGCRLLIVGYESGDPQILKNIK 319
gi 499560043 241 ALKTF-PQVKEFFFDDDTFTDDRPRAEAIARELGKLGVTWSCNAKANVPYETLKVLKDNGLRLLLVGYESGNQQILHNIK 319
gi 500008409 238 ALEQF-PQMKEIFFDDDTFNYRKERTIELCKKLKPLNFTWSCTSRVTTDYETLKAMKEAGCRLLIVGYESGDQQILKNIK 316
gi 490647489 239 IVDNI-PEMRELSFDDDTFTADRKHAREVAAKLKPLGISWTINARANCDYETLKIMREAGLRHVVVGYETGNEQILKNIK 317
gi 499705109 240 ARQMF-PEVREFFFDDDTFTDDLERVEEIAKGIGHLGVPWSCNAKANIPRKTLEVLKANGLRVLVVGYESGVQEILNNIR 318
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 501530511 321 KGLKVEAARKFTADCHKLGIVIHGTFILGLPGETKETIQKTIDFAKEINPHTIQVSLAAPYPGTFLYNQAKQEGWLTDED 400
gi 499620281 319 KGLRTDIARRFTEDCRKLGIQIHGTFILGLPGETQQTIEKTIAYAKEINPHTIQVSLAAPYPGTTLYQQAVDNGWLEENK 398
gi 499933438 320 KGIKLEVARKFMENCHKLGIKVHGAFILGLPNESQETIEETIRFACEVNPHTIQVSIASPYPGTELYTQAEKNGWFTGDS 399
gi 499842387 320 KGATVERARAFTKDCHKLGLKVHGDFILGLPGETKETIRRTMDFAKELDVETIQVSIAHAYPGTELYDYAKANGFIVQEG 399
gi 499560043 320 KGMRVETAEKFTRDCHDLGIAIHGTFILGLPGETRETIEQTIKWACEINPHTIQVSLAAPYPGTLLYKQAIENGWLDQSH 399
gi 500008409 317 KGATVDMAERFTANCKKLGLLVHGDFIIGLPGETRESIRKTIDFAKRLDNETIQVSIAHPYPGTEFYDYVKQNGLITIDS 396
gi 490647489 318 KGVTKEQAIEFTRNCKKLGLSVHGAFIMGLPGETRDTIRETIEYAKALDLNSIQASLASPYPGTEFWDLCRQEGWIASEA 397
gi 499705109 319 KGLRIDIIKRFSQDCHELGIVVHGTFILGLPGETRETIKQTLAFAKEVNPRTLQVSMAAPYPGTELYEQAIANGWFKQDK 398
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 501530511 401 EAHl--VNDRGVQISPMSYPHLNHTEIFDSVEVMYKRFYFRAGKIAEITGEMLKSTQMMKRRLREGVEFVRFLRQRHG 476
gi 499620281 399 VINl--VNDKGVQLAAISYPHLSKEEIYHGVERFYKQFYFRPGKIWEIVREMLGSWDMMKRRLREGVEFFRFLRSHEA 474
gi 499933438 400 --L---VASSGIQMSALQYPHLSGSEIEDGVEQMYRRFYFRPKSIIPIVGEMLADPQMLVRRLREGKEFLSYLRERHQ 472
gi 499842387 400 AAM---VDDQGHQVAMIEYPGLPRDYVMEMVHKFYDEYYFRPKAIFRIVRKAVFNNVERKRLYKEAKDFMKLRSVRNK 474
gi 499560043 400 AEL---VDEHGVQIAPLSYPHLSHEEIFRSVETFYKRFYFRPGKVFSIVNEMVRDFDMMKRRLREGVEFFQFLRERKE 474
gi 500008409 397 --M---TDENGHQLPNVVYPGLDRGELVEWVERFYGEYFFRPKVVWRIVRKAIFNSDERRRLTKEAREYMALRSKRRK 469
gi 490647489 398 Y-----IDDTGHQMCVINYPHLSNKEIFDAVELFYNKFYFRPKYIGRSIMKMIVDGEERKKLLKEGKQYLEYMRKRKA 470
gi 499705109 399 DLVmkeTGGGGWQVAALSYPDLSSEEIFKGVAEFYKAFYFRPSKIGEIVWEMLHDWDMMKRRLREGVEFFQFLRTRNK 476
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap