Conserved Protein Domain Family
HpnI

?
TIGR03472: HpnI 
hopanoid biosynthesis associated glycosyl transferase protein HpnI
This family of genes include a glycosyl transferase, group 2 domain (pfam00535) which are responsible, generally for the transfer of nucleotide-diphosphate sugars to substrates such as polysaccharides and lipids. The member of this clade from Acidithiobacillus ferrooxidans ATCC 23270 (AFE_0974) is found in the same locus as squalene-hopene cyclase (SHC, TIGR01507) and other genes associated with the biosynthesis of hopanoid natural products. Similarly, in Ralstonia eutropha JMP134 (Reut_B4902) this gene is adjacent to HpnAB, IspH and HpnH (TIGR03470), although SHC itself is elsewhere in the genome. Notably, this gene (here named HpnI) and three others form a conserved set (HpnIJKL) which occur in a subset of all genomes containing the SHC enzyme. This relationship was discerned using the method of partial phylogenetic profiling. This group includes Zymomonas mobilis, the organism where the initial hopanoid biosynthesis locus was described consisting of the genes HpnA-E and SHC (HpnF). Continuing past SHC are found a phosphorylase enzyme (ZMO0873, i.e. HpnG, TIGR03468) and another radical SAM enzyme (ZMO0874), HpnH. Although discontinuous in Z. mobilis, we continue the gene symbol sequence with HpnIJKL. Hopanoids are known to feature polar glycosyl head groups in many organisms.
Statistics
?
PSSM-Id: 132512
View PSSM: TIGR03472
Aligned: 9 rows
Threshold Bit Score: 463.773
Threshold Setting Gi: 73538725
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499571409   5 LTIAAGFCALVSAAGNLQALAGATLLARFRR------T-ERRADdalrlsdRTW--PSVTVLKPLHGNEPLLEDALESVF 75
gi 499560042   9 LTIIGSLALLMALAGVGYTILAAIVVLWWQQ------K-EVIKR-------KAW--PSVSLVKPLHGDEPALTENLLTFL 72
gi 497579221  33 acllaapcaiaaaFGCAYTLVAAALTHRFFA------R-APREP-------RAC--PPVTIVKPLHGNEQTLFANLASFC 96
gi 499243818   1 mtpdtllpllavlpplaYGLLALFCARAWFG------R-QRPGP-------GHT--PPVTILKPVKGMDAESFENFASFC 64
gi 499705110   5 WQGLCLVLIALTVAGCLFQVASAALVRRFRR------A-PEPVP-------AAR--PPISVMKPLCGAEHGMAANLDSCL 68
gi 490662455   5 LSIVGWVLLALVCASCGYAVLAACAPAPRVP------R-AARAR-------DGF--EPVSVLKPLCGSEPHLYENLATFC 68
gi 499673348  11 AGAMSIVCGLGVLLGIAYTITASVLVGRFFS------R-AADEP-------RDY--PGVTVAKPLHGDEWQLVQHLESFF 74
gi 497252244   2 CWWIGGPAALLSLAAVVYLLLALRAIARWHPvlperdA-AVSGD-------ILCdgPGVSVLKPLHGDEGDLYAALRSFC 73
gi 499620280   7 AMAATLLGSALTCVSAGYAVAAAVLTRRAGA------RaPAAAA-------AGE--VRASVLKPLCGAEPRLYDNLATLC 71
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499571409  76 TQDYPD-FQIVFGVQDREDTALAVIERLRARHPRIPVSVVINPQEHGPNRKVGNLMNMYGEARHDIIVISDSDIHASPNY 154
gi 499560042  73 KQDYPAeYEMLCGIQNPDDPAGETVREIASTSNQTAVRLIVDSKSHGTNAKISNLINITAHIGHDILIISDSDMSVPEGY 152
gi 497579221  97 EQRYDGpIQFLFGVHDRDDPALRAVDALRDAFPGAHVTIVADARLYGPNRKIANLVNMLPAAVHDVLIFADSDVSVGPDY 176
gi 499243818  65 RQEYGGpWQMLFACASADDPVIPVIRRLMAEFPDRDIDLVVDGTIHGPNYKVSNLINAFPRARHDILIVCDSDIRVTSDY 144
gi 499705110  69 RQDYPR-FQLVFGVADPADPALDVVKALPGDVEGAEIDWVADSARHGHNLKVGNLLNMWPKVRHDVIAIADSDIRVGPHY 147
gi 490662455  69 EQRHPR-YQLLFGVASAADPAIAVVRRLQADYPDCDIELVIDARVYGSNLKVSNLVNLAERARHGRIVIADSDIAVEPDY 147
gi 499673348  75 VQNYPGpVQHLFGVHDANDKALAAVETLRARYPDANIKVVADARLYGPNRKIANLVNMLEHAEYSVLCLADSDVLVERDY 154
gi 497252244  74 VQDYPA-FEIVFGVQRPDDPAVTVVQRLQAEFPALALRWVCTEARIGSNPKVNNLAGILALCRYDTLVISDADISVGPHY 152
gi 499620280  72 RQSVTG-YQVVCGVRDPDDPAIAVVRRLQQDFPDIDITLVIDPRVHGSNLKVSNLINLAAHARHDLLVVADSDIAVPPDY 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499571409 155 LRHVVTSLKEQGTGLVTTLYAGRPAAGtIVQQLGACQINHNFLPGVMMSRFLGRQD-CLGATMALRRQTLEEIGGLEALV 233
gi 499560042 153 IRQVVHALEKKDVGAVTCLYHGRGDNG-YWSRLSAANIDYNFLPSVMVGVALRKANpCMGSTIAIKRETLEAIGGFNSLA 231
gi 497579221 177 VRHIVGELDEPDVGLVTCVYRGRPDPG-FWPRVEALVTNHQFLPGVVTGLALKLARpCFGQTIAMRRATLDAIGGLAQFA 255
gi 499243818 145 LGEVTAPFADPAVGLVTSLYRSPGVRG-AATALEAMGFTVEMVPNVMVAQRLEGLSfALGASMAVRRTALESIGGFPALT 223
gi 499705110 148 LDDLAAPFDDPKVGIVTCLYVGRPEPD-LWSSLGAMGINHGFLPGAVLARAIGRKDgCFGATMAVRREVLEKGGGLAALS 226
gi 490662455 148 LTRVTAPLADPSVGVVTCLYHARSVGG-FWTRIGAQFVDAWFAPSVRITHLGGSSRfGFGATLALTRATLDAIGGFKALK 226
gi 499673348 155 LRAVVGALQQPDVGIVTSVYRGIASPG-FWPGVAVAMTNYHFLPGVITGLFIGRARpCFGQTIAFTRATLERIGGLTRFA 233
gi 497252244 153 LRQICASLQNRDVGVVTCLYRARPVAT-FWSRVLAGQVNGLFLPSVLLAARLGPNIfCGGATMALRRPTLAAIGGLPRLA 231
gi 499620280 151 LARVAAPLADPGVGIVTCLYRGRPVDA-FWAKLGAQFIDDWFAPSVRIAHAGGSRRfAFGATIALRRDTLTQIGGFASLS 229
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499571409 234 DHVADDAELGQLIRARGENITIAPTLTHTTVGEHSISDLLAHELRWGRTVKNVAPVGYGLS--AIQLPLFWAVTAVLFrp 311
gi 499560042 232 NILADDYVLGAKVRALGLRVEVIPVILTHSCTETSFSSLVRHELRWSATIRDINPVGFFGS--AVTYPVPLAFIGLML-- 307
gi 497579221 256 HHLAEDHAIGEAVRACGARVVVPPFAIEHGCVETRVAQLVEHELRWSRTIRAVDPRGHLGSllTHPLALALLASVLSS-- 333
gi 499243818 224 HYLADDYQLGNKIHRAGWRLELSDCFVESVMHRENLTTVLSRQLRWCRTMRASRPGGYLGS--GITQPVPLACLALLVsg 301
gi 499705110 227 QVLADDWVLGRMVRDQGLEIVLAARPVDMNVHEPSLKTLLDHEIRWGRTIAAVDRTSYMAS--VITQPVALAALAVLA-- 302
gi 490662455 227 DELADDYWLAELPRRLGLRTVLSEVNVATDVAEPSFAPLWLRETRWLRTIRSLNPAGFAFL--FITFTAPWLVIGAAL-- 302
gi 499673348 234 HHLAEDHALGEAVRQVGAQVVIPPFVVGHACVEETFAKLYAHELRWSCTIRAADRLGHAGS--VLMHPVPLALLALLFsg 311
gi 497252244 232 NQLADDYWLGAYSRQLGQATLLADYVVDTEVREANFRAFYQHALRWSRTTRSVQPLGHTFS--F----LTYPLPLVLL-- 303
gi 499620280 230 DRLADDFWLGELTRQAGLRTVLSDVVVTTDVTETRLPELWTHELRWLRTIRSLNPAGFAFT--FITFTWPMLVVGVVL-- 305
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499571409 312 NAWW-TWF------MLLLTW---LVRAIGSRIMDRAT---ECPLPAAIp---L-LVVRDWLSAAIMVGSARGSRVAWRGR 374
gi 499560042 308 TNGWvSWP------VFCLAL---ASRWLLGWRINRVT---GVSRMDAL----LqLPFRDLLSFGIFLSTFFISSVDWQGM 371
gi 497579221 334 GAAW-AWP------LVPASL---AARAVSKCIVDHAT---KRPVRDLW----P-LPLADLIAFGIFVASFSSSRVIWRGF 395
gi 499243818 302 CSAA-GWG------AVILLY---LTRALVAVTFSRRYlrdGIFPRWLW----L-LPLRDILAFATWALSFAGNRVRWRGN 366
gi 499705110 303 GGAW--WP------SVAALAlavLCRLWAVRVEERAL---GLPRCGLG----L-LGMREILSFVVYVVACCGRTVVWRGR 366
gi 490662455 303 -AAW-LGPasaagaTAAWAA---AIGTLARLALHARG---AAGWRAFWrdlpL-VPVRDALLALEWLAAAFGTQVVWRGA 373
gi 499673348 312 GTTA-ACG------LVAAAL---AARALLMLKTSRAT---GAGLRGAL----W-LPFVDLLQFFVFVSSFFSSHVVWRGT 373
gi 497252244 304 LAPW-MGL------WGGVPL---GVVLLLRLVYHRQImhkLSADGSFG----V-ALLGEFLGLWIWFHALFARHVAWRGS 368
gi 499620280 306 -SPA-EWT------TAIA-----VAGALARSAMARTP---TTALRA---------PLRDTLLLIGWAAALGGQRVRWRQQ 360
                        410
                 ....*....|...
gi 499571409 375 TVHIARRKRNSAS 387
gi 499560042 372 ELTLHSDGRISRK 384
gi 497579221 396 SFDVDRDGRLCPA 408
gi 499243818 367 LFRLLPGGKIVEI 379
gi 499705110 367 RFAVRADGTLDQV 379
gi 490662455 374 RMTVVGGDARATV 386
gi 499673348 374 RFRVDREGLLSPA 386
gi 497252244 369 QFAIGADGRMDGH 381
gi 499620280 361 VLSVQDPA----- 368
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap