Conserved Protein Domain Family
HpnK

?
TIGR03473: HpnK 
hopanoid biosynthesis associated protein HpnK
The sequences represented by this model are members of the pfam04794 "YdjC-like" family of uncharacterized proteins. The member of this clade from Acidithiobacillus ferrooxidans ATCC 23270 (AFE_0976) is found in the same locus as squalene-hopene cyclase (SHC, TIGR01507) and other genes associated with the biosynthesis of hopanoid natural products. Similarly, in Ralstonia eutropha JMP134 (Reut_B4902) this gene is adjacent to HpnAB, IspH and HpnH (TIGR03470), although SHC itself is elsewhere in the genome. Notably, this gene (here named HpnK) and three others form a conserved set (HpnIJKL) which occur in a subset of all genomes containing the SHC enzyme. This relationship was discerned using the method of partial phylogenetic profiling. This group includes Zymomonas mobilis, the organism where the initial hopanoid biosynthesis locus was described consisting of the genes HpnA-E and SHC (HpnF). Continuing past SHC are found a phosphorylase enzyme (ZMO0873, i.e. HpnG, TIGR03468) and a radical SAM enzyme (ZMO0874), HpnH. Although discontinuous in Z. mobilis, we continue the gene symbol sequence with HpnIJKL.
Statistics
?
PSSM-Id: 132513
View PSSM: TIGR03473
Aligned: 8 rows
Threshold Bit Score: 397.575
Threshold Setting Gi: 83719869
Created: 9-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499244272   1 MKRVIINADDFGLSDGVNRAVIKAWQEGILTSASLMVGGDAFHEAVHLAKANPGLHVGLHLTLVQGRAVGEHGGFPSICD 80
gi 499560044   1 MKKLIVTADDFGAATVVNEAVEKAHIDGVLTAASLMVGAPAAFDAVERARRLPKLGVGLHLVLVEGRPVLPPDEIPDLVD 80
gi 499812101   9 QRMLIITADDFGLHPRVNEAVELAYRHGVLTAASLMAGAPAAEDAIARARSLPGLCVGLHLVLADGMPVLPRESIPALVD 88
gi 499704742   2 SKRLIVTADDFGRSLEINRAVEDGHANGILTAASLMVTEGAVDDAVERARRLPGLGVGLHVTLVDGIPALAPSQIPDLVD 81
gi 501530510   6 GRRVIFNADDFGLDMAVNEAVESAHRDGVLTTASLMVAAPAAADAVARARALPGLGVGLHLTLVDGTPLLPAEQVPDLVD 85
gi 499837111   4 GQLLIVTADDFGLHHDINEAVERAHCQGILNAASLMVSSPAAADAVERARRLPGLRVGLHLVLADGVATLPYDQIPDLVD 83
gi 497575870   8 PRALIFTADDFGLHERVNAAVERAHRDGVLSAASLMVGASAARDAVERAKRLPSLAVGLHIVLADGPATLPAREIPALVG 87
gi 499571407   6 LRRAIVSADDFGMSLEVNEAIEQAHRNGILSTTSLMVAGDAAEDAIRRAKTMPDLKVGLHVVAIEGKSVL---DLPAITD 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499244272  81 SKGAFSDDPVQTGMRYFFIRSFRKQLYREIEAQIVRFLQTGLPLSHVDGHLNIHMHPVVFDLLCGLMRKHGITTFRLCRE 160
gi 499560044  81 RDGMFRRNMVRAGVDIFFRPGVRRQLVREINAQFSAFAATGLKLDHVNAHKHFHLHPTISNLILAIGRRYGLKAMRAPVE 160
gi 499812101  89 GEGRFGSNMVRDGFRFYFLPHVRAQLALEIRAQFEAFAKTGLPLDHVNTHKHFHLHPTVLSLIIEIGRDFGMRAMRLPGE 168
gi 499704742  82 GNGLFTLDLVRLGTRIFLSKAAQRQVSAEMRTQFELFKATGLPLAHVDFHHHYHQHPTVFALVLDLAVEYGAPGIRIPWE 161
gi 501530510  86 EQGRFAADLWRRGVRYFFLPQVRKQLAAEIRAQFAAFAATGLELDHANAHKHLHLHPTVLTQMLEVGKEFGLRAVRLPWE 165
gi 499837111  84 ASGRFGSAMVRDGFRFFFLPRVRAQLAAEIRAQFEAFAATGLPLDHVNAHKHFHLHPTVLSLILSIGRDYGMRAVRLPRE 163
gi 497575870  88 PDGRFRDAMAKDGCRFFFLPHVRAQLRREIRAQFEAFAATGLALDHVNTHKHFHLHPTVLSMIVDIGREFGLAAMRLPYE 167
gi 499571407  83 EQGWFGRNQLRLGVEYFFCPAARHALRREIAAQFRAFAATGLTLDHANAHKHMHLHPTVGHFLIESGLEHGLQAVRSPFE 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499244272 161 NlRANLTLDRERRFGKMVdaFIFSKLaG--RCRPILDHLGIGYAQEVKGLLNSGRMTEEYLLRVLDTLED-GTTELYFHP 237
gi 499560044 161 PiNILAEIEPVTRHLPDY--VAMPWA-Y--GIRKRSVNAGLLVPDQTFGIAWTGHMTPHRMLGLIEHLPE-GLSEIYVHP 234
gi 499812101 169 ------------RNAPLW---LRPWM-S--LVRARLDRAGIAHNDYVIGLADTGHMNESAWLAALERLPG-GVGEIYCHP 229
gi 499704742 162 P-PLLSYRARGDRLGTRLsnGLFHWR-RnrAMAAKAKARGLVVNERAFGLNDSGQMDAAKVNSFLGVLPE-GLSEIYCHP 238
gi 501530510 166 PlRAARCSGAKGVAPTFWsiFLAPWL-A--RMRRQLDRRRIMHNDQLYGLDATGHMDEERLLRMLRCLPAtGVTEIYLHP 242
gi 499837111 164 A-GGPLLLRPWLALL-----------------RARLQRAGIAYNDYVLGLSDTGAMDEATLLAAFEQLPR-GVVEMYLHP 224
gi 497575870 168 P------------STPFW---LKPWI-A--LVRARLDRAGIAHNDYVVGIERTGAMDEAALLAALAKLPA-GVGEIYSHP 228
gi 499571407 163 P------PEPVEANDTLGdrALRHWI-G--VLRHQIRKAGLKTNDWCFGLRWSGHMTPDHIRGLIPRLPE-GTSEIYFHP 232
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*...
gi 499244272 238 GCLPCAEITRrmPDYRHEEELAALMSPRVKGRLKELGIELGNYRGEVK 285
gi 499560044 235 AVSDEYEGHA--QGYESIEEWHALTDEAVKKALKERQIELGNFSDFLG 280
gi 499812101 230 ATAGDAPLTPgmQSYRHADELDALLSPRVAEAIGAAGATRGGFADLLA 277
gi 499704742 239 ATAHWSGARPmpPHYRIDDEYKALIAPENRRKVEELGITLTTFAAEAR 286
gi 501530510 243 AMVQTAALHAlmPNYEPHAEWAALTSPRVKDYLRDQDIAKGTFRDFVA 290
gi 499837111 225 AVTSGAEVGAsmTGYRHADELAALLSPRVRAAADRFAPRRGGFTDLHA 272
gi 497575870 229 AEAGDGPITPsmRDYRPADELAALLSPRVAAAVQAAGVACGGFADVFG 276
gi 499571407 233 ATAQNSMMKRfmPGYEQESELAALLDPAVRASFDRYGVTRIGWADL-- 278
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap