2IVF


Conserved Protein Domain Family
DMSO_red_II_bet

?
TIGR03478: DMSO_red_II_bet 
Click on image for an interactive view with Cn3D
DMSO reductase family type II enzyme, iron-sulfur subunit
This model represents the iron-sulfur subunit, typically called the beta subunit, of various proteins that also contain a molybdopterin subunit and a heme b subunit. The group includes two distinct but very closely related periplasmic proteins of anaerobic respiration, selenate reductase and chlorate reductase. Other members of this family include dimethyl sulphide dehydrogenase and ethylbenzene dehydrogenase. [Energy metabolism, Anaerobic, Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 132518
View PSSM: TIGR03478
Aligned: 6 rows
Threshold Bit Score: 608.327
Threshold Setting Gi: 63029706
Created: 9-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IVF_B       16 KRQLVTVIDLNKCLGCQTCTVACKNIWTKRPGTEHMRWNNVTTYPGKGYPRDYERKGGGFLR---GEPQPGVLPTLIDSG 92
gi 38605511   3 QRQLAYVFDLNKCIGCHTCTMACKQLWTNRDGREYMYWNNVESRPGKGYPKNWEQKGGGFDKd-gKLKTNGIIPIRADYG 81
gi 38604882   3 KRQISMVLDLNKCIGCQTCTSACKLQWTNRNGREYMYWNNVETHPGPGYPRNYEHSGGGFDEe-gALKI-GITPSAEDYG 80
gi 14994028  16 KRQLVTVIDLNKCLGCQTCTVACKNIWTKRPGTEHMRWNNVTTYPGKGYPRDYERKGGGFLRg---ePQPGVLPTLIDSG 92
gi 63029706   9 KRQLAYVADLNKCIGCQTCTVACKTLWTSGPGQDYMYWRNVETAPGLGYPRNWQSKGGGYKd--gVLQK-GKIPPMIDYG 85
gi 18447895  23 DHQVAMVMDLNKCIGCQTCTIACKNLWTEDGGSEYMYWNNVETKPGEGYPRGWENSGGGWKSgehKERQPGEIPDEEDYG 102
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IVF_B       93 DDFQFNHKEVFYEGKGQTVHFHPTskstgkdPAWGYNWDEDQGGGKWPNPFFFYLARMCNHCTNPACLAACPTGAIYKRE 172
gi 38605511  82 GTWNYNLLETLVEGKSNQVVPDEK-------PTWGPNWDEDEGKGEFPNNHYFYLPRICNHCSNPACLAACPTKAIYKRE 154
gi 38604882  81 IPWEYNYEEALMTGTDPWLRPNVK-------PTWGANWNEDEGRGEYPNSYYFYLPRICNHCANPGCLAACARNAIYKRQ 153
gi 14994028  93 DDFQFNHKEVFYEGKGQTVHFHPTskstgkdPAWGYNWDEDQGGGKWPNPFFFYLARMCNHCTNPACLAACPTGAIYKRE 172
gi 63029706  86 VPFEFDYAGRLFEGKKERARPSPT-------PRYAPNWDEDQGAGEYPNNSFFYVPRMCNHCAKPACLEACPNEAIYKRE 158
gi 18447895 103 RAWEFNHEEIMYEGSDEPLRPRDG-------AEWGPNWDEDQGAGEYPNSYYFYLPRICNHCTHPSCVEACPRSALYKRQ 175
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IVF_B      173 DNGIVLVDQERCKGHRHCVEACPYKAIYFNPVSQTSEKCILCYPRIE------KGIANACNRQCPGRVRAFGYLDDTTSH 246
gi 38605511 155 EDGLVVVDQSRCKGYRYCVKACPYGKMYFNLQKGTSEKCIGCYPRVE------KGEAPACVKQCSGRIRFWGYRDDKDGP 228
gi 38604882 154 EDGIVLVDQERCRGYRYCITACPYKKVYFNEQISKAEKCIFCYPRIE------KGLPTACAKQCVGRIRFIGYLDDEAGP 227
gi 14994028 173 DNGIVLVDQERCKGHRHCVEACPYKAIYFNPVSQTSEKCILCYPRIE------KGIANACNRQCPGRVRAFGYLDDTTSH 246
gi 63029706 159 QDGLVVIHQEKCKGAQACIQSCPYAKPYFNAQVNKANKCIGCFPRIE------KGVAPACVAECAGRAMHVGFIDDQESS 232
gi 18447895 176 EDGIVLVDQDRCRGYRYCVEGCPYKKVYYNTVSKKSEKCIFCYPRIEgegpdgETFAPACAEECPPQLRLVGFLDDEEGP 255
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IVF_B      247 VHKLVKKWKVALPLHAEYGTGPNIYYVPPM--GARGFGEDGEITDKTRIPLDVLEGLFGPEVKRVLAVLHTERENMRAGR 324
gi 38605511 229 IYKLVDQWKVALPLHAEYGTEPNVFYVPPMntTPPPFEEDGRLGDKPRIPIEDLEALFGPGVKQALATLGGEMAKRRKAQ 308
gi 38604882 228 VHLLVERYKVAIPLHPEWGTKPSVFYVPPL--APPRIGDDGEPTEETRVPLAYLKELFGEAVVPALETLKTERAKKQSGA 305
gi 14994028 247 VHKLVKKWKVALPLHAEYGTGPNIYYVPPM--GARGFGEDGEITDKTRIPLDVLEGLFGPEVKRVLAVLHTERENMRAGR 324
gi 63029706 233 VFKLVKRFGVALPLHPEYGTEPNVFYVPPVl-GPRVEMPNGEHTADPKISMTQLEQLFGKQVREVLKTLQAEREKKIKNQ 311
gi 18447895 256 IHKLVNEYEVALPLHPEFRTQPNVYYIPPF--APGQHTEDGETVDIDRIPRQYLRDLFGDGVDQALDTIERERQRARQGE 333
                       330
                ....*....|....*..
2IVF_B      325 GSELMDLLISKKWSDRF 341
gi 38605511 309 ASELTDILIGYTNKDRY 325
gi 38604882 306 ESELMDTLIGYRHPEMF 322
gi 14994028 325 GSELMDLLISKKWSDRF 341
gi 63029706 312 PSELMDILIGRRSADMM 328
gi 18447895 334 DSELMELLQDKNPAKQY 350
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap