2IVF


Conserved Protein Domain Family
DMSO_red_II_alp

?
TIGR03479: DMSO_red_II_alp 
Click on image for an interactive view with Cn3D
DMSO reductase family type II enzyme, molybdopterin subunit
This model represents the molybdopterin subunit, typically called the alpha subunit, of various proteins that also contain an iron-sulfur subunit and a heme b subunit. The group includes two distinct but very closely related periplasmic proteins of anaerobic respiration, selenate reductase and chlorate reductase. Other members of this family include dimethyl sulphide dehydrogenase, ethylbenzene dehydrogenase, and an archaeal respiratory nitrate reductase. This alpha subunit has a twin-arginine translocation (TAT) signal for Sec-independent translocation across the plasma membrane.
Statistics
?
PSSM-Id: 132519
View PSSM: TIGR03479
Aligned: 6 rows
Threshold Bit Score: 1420.34
Threshold Setting Gi: 14994027
Created: 9-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IVF_A       21 RRDFLKRSG-AAVLSLSLSSl--aTGVVPGFLKDAQAGT-KAPGYASWEDIYRKEWKWDKVNWGSHLNICwpQGSCKFYV 96
gi 38605512  14 RRRFLQFSM-AALASAAAPS----SVWAFSKIQPIEDPL-KSYPYRDWEDLYRKEWTWDSTGFITHSNGC--VAGCAWRV 85
gi 38604883   6 RRTLMQG---ASLVGAGLFAa--gRGWALNRLEPIGDTLaEEYPYRDWEDLYRNEFTWDYVGKAAHCINC--LGNCAFDI 78
gi 28911901   6 RRDFLKASA-ATLLG---------NSLTFKTLAATMDLS-GAFEYSGWENFHRNQWSWDKKTRGAHLINC--TGACPHFV 72
gi 14994027  21 RRDFLKRSG-AAVLSLSLSSl--aTGVVPGFLKDAQAGT-KAPGYASWEDIYRKEWKWDKVNWGSHLNICwpQGSCKFYV 96
gi 41349577  46 RRTFLEGIGvASLLGIGTSAasddSLFQMGGLKPVDDPI-GNYPYRDWEDLYREKWDWDSVSRSTHSVNC--TGSCSWNV 122
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IVF_A       97 YVRNGIVWREEQAAQTPACnVDYVDYNPLGCQKGSAFNNNLYGDERVKYPLKRVGKRGEGKWKRVSWDEAAGDIADSIID 176
gi 38605512  86 FVKNGVPMREEQVSEYPQL-PGVPDMNPRGCQKGAVYCSWSKQPDFLKYPLKRVGERGERKWKRISWDEAFTEIADKIID 164
gi 38604883  79 YVKDGIVIREEQLAKYPQIsPDIPDANPRGCQKGAIHSTSMYEADRLRYPMKRVGARGEGKWQRISWDQATEEIADKIID 158
gi 28911901  73 YTKDGVVIREEQSKDIPPM-PNIPELNPRGCNKGECAHHYMYGPHRLKYPLIRVGERGEGKWRRATWEEALDLISDKIID 151
gi 14994027  97 YVRNGIVWREEQAAQTPACnVDYVDYNPLGCQKGSAFNNNLYGDERVKYPLKRVGKRGEGKWKRVSWDEAAGDIADSIID 176
gi 41349577 123 YVKNGQVWREEQSGDYPRFdESLPDPNPRGCQKGACYTDYVNADQRIKHPLKRVGERGEGKWKRISWDEALTEIAEHVVD 202
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IVF_A      177 SFEAQGSDGFILdaPHVHAGSIAWGAGFRMTYLMDGVSPDINVDIGDTYMGAFHTFGKMHMGYSADNLLDAELIFMTCSN 256
gi 38605512 165 TTVKRGPGNVCM--PKRPFAVITSAGYSRLANLIGAIKPDVSSMTGDLYPGIQTVRMPARTVSTFDDWFTSDLILMWHKN 242
gi 38604883 159 IYEKYGPGKLMThtGSGNMSMMRMAAPYRFASLVGGVQLDIFTDVGDLNTGAHLAYGNALESFTSDAWFGADYIMFLLFN 238
gi 28911901 152 TIKNHSPDCISVysPLPGTAPVSFSAGHRFAHYIGAHTHTFFDWYSDHPTGQTQTCGVQGDSAECSDWFNSKYIILWGAN 231
gi 14994027 177 SFEAQGSDGFILdaPHVHAGSIAWGAGFRMTYLMDGVSPDINVDIGDTYMGAFHTFGKMHMGYSADNLLDAELIFMTCSN 256
gi 41349577 203 EVEAGRYDAISGftPIPAMSPVSFASGSRLVNLLGGVSHSFYDWYSDLPPGQPITWGTQTDNAESADWYNADYIIAWGVE 282
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IVF_A      257 WSYTYPSSYHFLSEARYKGAEVVVIAPDFNPTTPAADLHVPVRVGSDAAFWLGLSQVMIDEKLFDRQFVCEQTDLPLLVR 336
gi 38605512 243 PIVTRIPDAHFLTEARYNGARLVNISPDYNPSSVHADLHLPVTTGTDSHLAAAIVNVLIADKKYKADYLKEQTDLPFLVR 322
gi 38604883 239 PVATRIPDAHFLWEAKWNGARVVSVAPDYNPSSIHSDLWMPIKQGADPFLAMSMVNVIIEGKLYNEAFMKEQTDLPILVR 318
gi 28911901 232 PTQTRIPDAHFLSEAQLNGAKVVSISPDFNSSTIKADRWIHPLPGTDGALALAMAHVIIKEKLYDAHNLKEQTDLPYLIR 311
gi 14994027 257 WSYTYPSSYHFLSEARYKGAEVVVIAPDFNPTTPAADLHVPVRVGSDAAFWLGLSQVMIDEKLFDRQFVCEQTDLPLLVR 336
gi 41349577 283 INVTRIPDAKYFLESGYNGTKRVGVFTDYSQTAIHTDEWLSPDSGTDTALALGMAQTIVDEGLYDEAHLKEQTDMPLLVR 362
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IVF_A      337 MDTGKFLSAEDV------DGGEAKQFYFFDEKaGSVRKASR------GT-------------------LKLD-FMPALEG 384
gi 38605512 323 TDNGKFLREKDFn-----KDGSDEVFYIWDSKsGKAVLAPGsmgskdKT-------------------LKLGaVEPALEG 378
gi 38604883 319 SDNGMLLREADLe-----EGGSDQVFYHWDSRtGAAVKVKGsmgseeKT-------------------LVLGdVDPALEG 374
gi 28911901 312 RDTKRFLREADVv-----AGGSKDKFYIWDSKtGKPVITKGswgdqpEQkappvafmgrnthtfpkgyIALEnLDPALEG 386
gi 14994027 337 MDTGKFLSAEDV------DGGEAKQFYFFDEKaGSVRKASRa-------------------------tLKLD-FMPALEG 384
gi 41349577 363 QDTGKFLRASDVpsvntdADRPEWMLLMLDSN-GRIREAPGslgerdGQkdy-------------sksIELD-FDPQLDG 427
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IVF_A      385 tfSArlkngKTIQVRTVFEGLREHL-KDYTPEKASAKCGVPVSLIRELGRKVAKKRTCSYI-GFSSAKSYHGDLMERSLF 462
gi 38605512 379 tfDA-----NGIEVTTVFARLKAEI-APYTPEATHKTTGIHPSVVRQLAGWIGDCKALRILdGYNNQKHFDGFQCGRLKI 452
gi 38604883 375 sfEV-----GGIPVTTVFEKVRAEA-AKYPPEETAAITGIGPGVVRAEAETFARAKKALLMtGFNIGRYSNGIYTSWALT 448
gi 28911901 387 kfQVklqdgNTVEVRPVFEILKSRIeADNNIAKAAKITGVPAKTIIEVAREYATTQPAMIIcGGGTMHWYYSDVLLRAMH 466
gi 14994027 385 tfSArlkngKTIQVRTVFEGLREHL-KDYTPEKASAKCGVPVSLIRELGRKVAKKRTCSYI-GFSSAKSYHGDLMERSLF 462
gi 41349577 428 --EQrsnpsGRVQVRTVWAELRDEL-ANWDPEMVHEETTVGKETYQRIAREFAEADKAKIIqGKGVNDWYHNDLGNRALQ 504
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IVF_A      463 LAMALSGNWGKPGTGAFAWAYsddnMVYLGVMSkptaqggmdelhqmaegFNkrTleadptsTDEMGniefmkvvtsavg 542
gi 38605512 453 LILTLIGHHGTTGSIDTTYEG----WVLEGNKA-----------------LG--GvkgrpgrSVSMV------------- 496
gi 38604883 449 LMLALTGHGGRTGGLDTSWIA----WNQPALLE-----------------LAffDfkk-lprLEAGG------------- 493
gi 28911901 467 LLTALVGSEGKNGGGMNHYIGqwkpVFLPGVAA-----------------LAfpEg-----pANERS------------- 511
gi 14994027 463 LAMALSGNWGKPGTGAFAWAYsddnMVYLGVMSkptaqggmdelhqmaegFNkrTleadptsTDEMGniefmkvltsavg 542
gi 41349577 505 LLVTLTGNLGEQGTGLDHYVGqekiWTFHGWKT-----------------LSfpT-------GKVRG------------- 547
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IVF_A      543 lVPPAMW--------LYYHVGydqlwNNKAwtdPALKksFGAYLDEAKEKGWWTNdhiRPAPd-----KTPQVYMLLSQN 609
gi 38605512 497 -LAQWVWgeqyrrskAYFDDT-----ELREqigFGVDe-MEALRKESEANGWMPN---WQSI------KDPVVYINAGIN 560
gi 38604883 494 -LGEFVRggmmehsrQHYDND-----KLKArtgFDLDe-LQEMIDESIDAGWMPY---Y---------GDMKGLISIADN 554
gi 28911901 512 -CQTTIW--------TYIHAE-----VNDEmanVGID--TDKYLMHAIDTRQMPN---YPRDg-----RDPKVFIVYRGN 567
gi 14994027 543 lVPPAMW--------LYYHVGydqlwNNKAwtdPALKksFGAYLDEAKEKGWWTN-----DHirpapdKTPQVYMLLSQN 609
gi 41349577 548 -VPTTLW--------TYYHAG-----ILDT---PNPD--TAAKIRESIDKGWMPV---YPEErdngsrPDPTTMFVRRGN 605
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IVF_A      610 PMRRKRsGAKMFPDVLFPKL-KMIFALETRMSSSAMYADIVLPCAWYYEKHEMTTpCSGNPFFTFVDRSVAPPGECREEW 688
gi 38605512 561 TFATST-GYQHLRENFLKRC-ELYVVVDFRLNSGAMYADIVLPAATNLEKLDIRE-TSSTRFIHAFGQPIKPMYDRRTDW 637
gi 38604883 555 KFRRNK-NAEAYRERILEEVeELFVDINVRMDSTAQWADYLLPAAAHYEAWDLRS-IAFHRFVNVFSRPVPPIGEAKSDW 632
gi 28911901 568 WLNQAK-GQKYVLRNLWPKL-DLIVDINIRMDSTALYSDVVLPSAHWYEKLDLNV-TAEHTYINMTEPAIKPMWESKTDW 644
gi 14994027 610 PMRRKRsGAKMFPDVLFPKL-KMIFALETRMSSSAMYADIVLPCAWYYEKHEMTTpCSGNPFFTFVDRSVAPPGECREEW 688
gi 41349577 606 YFNQAK-GNVAVEEQLWPKL-DLVVDINFRMDSTAMYSDIVLPTASHYEKHDLSM-TDMHTYVHPFTPAVEPLGESKTDW 682
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IVF_A      689 DAIALILKKVGERAAARGLTEFNDHN-GRKRRYDELYKKFTMD------GHLLTNEDCLKEMVDINRAVgv--faKDYTY 759
gi 38605512 638 QISVGLARKIQERARARGITRVDDPEiKSFIDFDKVYDEFTMN------GAVEKDEDALRFVMEKSKAL------GPGSY 705
gi 38604883 633 EIMEILTRKIQERAIARGITGYEDGDvTR--DFATIHDDYTMD------GTLMTDHDVVSWLVENGPEF------AGATL 698
gi 28911901 645 QIFLALAKRVEMSAKRKSFERFYDEQfKWARDLTNLWNQMTMD------GKLAEDEAAAQYILDTAPHS------KGITL 712
gi 14994027 689 DAIALILKKVGERAAARGLTEFNDHN-GRKRRYDELYKKFTMD------GHLLTNEDCLKEMVDINRAVgv--faKDYTY 759
gi 41349577 683 QIFRELAQKILEVATERGVEPISDRRfDREIDLQSVYDDYVRDwetgeeGALAEDRAACEYILEHSEESnpadsdEQITF 762
                       810       820       830       840       850       860       870       880
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IVF_A      760 EKFKKEGqtrFLSMGTGvsryaHANEVDVTKPIYPMRWHFDDKKVFPTHTRRAQFYLDHDWYLEAGESLPTHKDTP-MVG 838
gi 38605512 706 EEVLKRG---FVGVGPSa---gKTGPVPADKPYRPFTVNVSEKVPYKTLTGRLQFYIDHDWYQRFGATVPKPQYGGgVLG 779
gi 38604883 699 EEGVERG---FFVMGEDa---gPTQKLRPSEPYHAFLQQTEGKEPYKTMTGRITFFVDHPRFVRLGATVPTARHHAgRDA 772
gi 28911901 713 QMLREKGe-rFKAN--------WTSPMKEGVPYTPFQNYIVDKKPWPTLTGRQQFYLDHEVFFEMGVELPTYKAP--VDA 781
gi 14994027 760 EKFKKEGqtrFLSMGTGasryaHANEVDVTKPIYPMRWHFDDKKVFPTHTRRAQFYLDHDWYLEAGESLPTHKDTP-MVG 838
gi 41349577 763 ADTVEQPq-rLLEAGDH-----WTSDIEDGEAYAPWKDFVQDKNPWPTVTGRQQYYIDHDWFLELGEELPTHKEGSeNTG 836
                       890       900       910       920       930       940       950       960
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IVF_A      839 -GDHPFKITGGHPRVSIHSTHLTNSHLSRLHRGQPVVHMNSKDAAELGIKDGDMAKLFNDFADCEIMVRTAPNVQPKQCI 917
gi 38605512 780 pKKYPFVYNTPHTRWGVHSFARTDQWMLRHQRGEPDVRLNPAAMARKGIKDGDQVRIFNSSGEFFAMAKAWPGLPENMLF 859
gi 38604883 773 -SNYPLNFFSPHTRWGIHSNWRSNKFMLRLQRGEPNIYISPQLAAAKGIADGAQVRVFNELSFFFAQAKFYPSLPPDTIM 851
gi 28911901 782 -DKFPFRFNSPHSRHSIHSTFKDSVLMLRLQRGGPCVEISPIDATAIGVKDNDWVEIWNSHGKVICRAKIRAGEQRGRVS 860
gi 14994027 839 -GDHPFKITGGHPRVSIHSTHLTNSHLSRLHRGQPVVHMNSKDAAELGIKDGDMAKLFNDFADCEIMVRTAPNVQPKQCI 917
gi 41349577 837 -GDYPMEYNTPHGRWAIHSTWRDSEKLLRLQRGEPLLYLHPEDAEERGIEDGDSVEVFNDLAEVELQAKIYPSSQRGTAR 915
                       970       980       990      1000      1010      1020
                ....*....|....*....|....*....|....*....|....*....|....*....|..
2IVF_A      918 VYF-WDAHQYKGWKPYDILLIGMPKPLHLA----GGYEQFRYYFMNGSPAPVtDRGVRVSIK 974
gi 38605512 860 SEHgWEQYLYKNMTHYNSVNAELINPLELV----GGYGHVKFAAGGFNPNRI-FHETTVDVE 916
gi 38604883 852 MEHgWEPHQFPNWRPMNVCMATLLQPLELV----GGWGHLNFSLWHWNANQL-AHESSVDIE 908
gi 28911901 861 MWHtPELYMDLLEGSTQSVCPVRITPTHLV----GNYGHLVFRPNYYGPAGS-QRDVRVDVK 917
gi 14994027 918 VYF-WDAHQYKGWKPYDILLIGMPKPLHLA----GGYEQFRYYFMNGSPAPVtDRGVRVSIK 974
gi 41349577 916 MYFaWERFQFDSDSNFNSLVPMYMKPTQLVqypeDSGEHLHFFPNYWGPTGV-NSDVRVDVR 976
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap