Conserved Protein Domain Family
cas_csx13_N

?
TIGR03485: cas_csx13_N 
CRISPR-associated protein Cas8a1/Csx13, MYXAN subtype
Members of this family are found among cas (CRISPR-Associated) genes close to CRISPR repeats in Leptospira interrogans (a spirochete), Myxococcus xanthus (a delta-proteobacterium), and Lyngbya sp. PCC 8106 (a cyanobacterium). It is found with other cas genes in Anabaena variabilis ATCC 29413. In Lyngbya sp., the protein is split into two tandem genes. This model corresponds to the N-terminal region or upstream gene; the C-terminal region is described by TIGR03486. CRISPR/cas systems are associated with prokaryotic acquired resistance to phage and other exogenous DNA.
Statistics
?
PSSM-Id: 132524
View PSSM: TIGR03485
Aligned: 4 rows
Threshold Bit Score: 417.313
Threshold Setting Gi: 108758437
Created: 9-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119455654  10 LHFNLSEPNFTILHCLGLAGLAMSLKQIEKQYPLPAQRP-----GKLNWCVDSRNIDLYWQGQD-SLALDWLFKESFKID 83
gi 75703422   10 IQLNLGDPSMTLLHRAGVAGLWMTLKKLEKIYPTPAERI-----GNLTWLLTPHYINLDWEGQD-FTVLDWLLKQSFQIS 83
gi 24197096   18 VFQRGLSECTSPLLRAGLAGLYSTLYSLKDEKKP----------KTLSWELTQDSIQITSKGEF-SKDFQWIINHGYQTK 86
gi 521967524  16 LSIRLYAPGMTPLLRAGAGGLAASLRAILGSASPAAPWPspvrlGPGTATVEQEAIHLDWGGKApEATLRALFGASFRVK 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119455654  84 qRGLISFTGLNPESMPLPT---QIVNHQCLTnSSFLQHNKFFKSGGVASESITVDEIPIEVKY-----KRAVSYAHQNFA 155
gi 75703422   84 dEGLISLTGLDSQNMDIQN---QIIIHQGIT-ATFTQHNKFFKSAGQQSKQLIIDGIQVRVDY-----KKAASYAHQHFA 154
gi 24197096   87 -EGIFYCPGIHRTKTIHKD---RMHFHNAMM-GTFLQHGRIQVRTKGAGTAVSIEDECKLLYFpllveEKKIKYRKDAES 161
gi 521967524  96 -QGFIDLPGTRPPGAPEPPpelAAALHDALK-VTFLQHGKSTQGGARRRVTFEVDARPVIVES-----QGYDSFVHQTAW 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119455654 156 PKICDPQG--NLYQEPIQIVSWLYPGAIVRHAAAEKSTKIEETVEQAIALLYAPVACIYYLVRsrihNQKAQYAVVIPVI 233
gi 75703422  155 KHLCDQYG--QLLKEPIGIRGWLYPGAVVRHYAFKEQTAFEEKAEYALALLFAPMACQYFVLRshtePSHTNYVLVIPEV 232
gi 24197096  162 ILFAEKRGstWSFENLVELSGYVMPGAPPR---FTHETSWIGTIADAFLLFFAPLSCSFAEIE----PSRGTWCILIPEL 234
gi 521967524 169 QSVLEA-----LEVGSTSLASWAYPGAAERHIGVR-VTKVEYTAAEALCACFALVGCVSYKLP-----QLRGGAFVALAP 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119455654 234 TNLESYALQRLELNHLSYQELYVTGTGDAGLKSLYYLATSQTTDp--NKIQKCKVIVYGTFTWSKQQKVR-GDVKLIKST 310
gi 75703422  233 IDLELYAHFLWCLGNLDYKHFHVSSLGDAGLKFLNYKTTQMPTS---NFLKRCQIIFFSTKAWSEQQKTR-AEIAIIELN 308
gi 24197096  235 EDLETFERFRRDY-EVNTINMFAGGPGDAALRYLTEMDLTGNKKd--FSPNGCEVYVIGKVAWNKKQQVR-RLMMRIHPT 310
gi 521967524 238 TNLVRFAELRPGLTPKRLRDVAVAGASDAVLAAQLVMAQEAGKKrlgAVLGTTEAVALRQMPWNAQQKIRgAVVRQDAVL 317
                        330       340
                 ....*....|....*....|.
gi 119455654 311 VAVNHHYQLIHHLFPN-RAVK 330
gi 75703422  309 SSVNYLYKLSCICFPEcQIVL 329
gi 24197096  311 EKNFRIYKKMRGIFQNkIHLK 331
gi 521967524 318 EEVLDRYEAAAAALPHtLRVR 338
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap