2FN0,3LOG


Conserved Protein Domain Family
salicyl_syn

?
TIGR03494: salicyl_syn 
Click on image for an interactive view with Cn3D
salicylate synthase
Members of this protein family are salicylate synthases, bifunctional enzymes that make salicylate, in two steps, from chorismate. Members are homologous to anthranilate synthase component I from Trp biosynthesis. Members typically are found in gene regions associated with siderophore or other secondary metabolite biosynthesis.
Statistics
?
PSSM-Id: 132533
View PSSM: TIGR03494
Aligned: 8 rows
Threshold Bit Score: 679.193
Threshold Setting Gi: 81706979
Created: 9-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FN0_A        18 QWLPTISGVLRQFA-EEECYVYERPPCWYLGKGCQARLHINADGTQATF-IDDAGEQKWAv-DSIADCARRFMAHPQVKG 94
gi 83769476   16 DALQRVATVLSKLK-SDDYYAYERTGVWYLGIGNRSSVTIDPEGRKATFsTNGKDEVRSId-GGVTDVVREYTSANEDCG 93
gi 87251745   32 CDPQTLATALSGAEfCHDYVVYEHNGEWAIGINKLQQLTVDTQGRITDF-TGKVDQPNP---KDLCDAIHQATQALPWDG 107
gi 92110317   15 QWLPTISGVLRQFA-EEECYVYERQPCWYLGKGCQARLHINADGTQATF-IDDAGEQKWAv-DSIADCARRFMAHPQVKG 91
gi 81571246   28 DLAAELAVVLSERA-GEEYLLYERGGEWVLATGVRAMIELDSDELRVIR-DGVTQRQHWS--GRPGPVLGEAIDRLLLET 103
gi 81706979   28 DLAAELAAVVTESV-DEDYLLYECDGQWVLAAGVQAMVELDSDELRVIR-DGVTRRQQWS--GRPGAALGEAVDRLLLET 103
gi 121712273  15 DTLNVVTAVLAKHE-ANDYYAYEREEHWYVGLGAESSLLVDSQGKTVTVtTGSTERPRALddSSISDIAREFVDASLEFG 93
3LOG_A        30 DLAAELAAVVTESV-DEDYLLYECDGQWVLAAGVQAMVELDSDELRVIR-DGVTRRQQWS--GRPGAALGEAVDRLLLET 105
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FN0_A        95 RRVYGQVGFNFAAHARGIAFNAGEW-PLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEASTtt----qNAPL-- 167
gi 83769476   94 TRIYGYIGFSYALLLRGIPHTAGEW-PMLSLMVPRTEVVFYPDRITLTGVDKGETVELSALVDDTTC-------IEPSpg 165
gi 87251745  108 WRVFGRVDFEFSHFAHQLSHKMTHR-NLLELFIAQHDIRVTHDQVVIRTVAPSFLPHIERVIAEVTTplpvaepIAPLtq 186
gi 92110317   92 RRVYGQVGFNFAAHARGIAFNAGEW-PLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEAGTtt----qNAPL-- 164
gi 81571246  104 DQLFGWIAFEFGVYRYGLQQRLAPGtALARVFWPNGRIVVTREAIQLFGTSTGRRDDVLGVLGDG---------VPGLrd 174
gi 81706979  104 DQAFGWVAFEFGVHRYGLQQRLAPHtPLARVFSPRTRIMVSEKEIRLFDAGIRHREAIDRLLATG---------VREVpq 174
gi 121712273  94 SRIYGQVGFNYAAHIRGQTFNRGQW-PLLSLMVPRTEIVFHEDSVTVTGLHEEEVRSLYEFIKHDAArv----nIESLen 168
3LOG_A       106 DQAFGWVAFEFGVHRYGLQQRLAPHtPLARVFSPRTRIMVSEKEIRLFDAGIRHREAIDRLLATG---------VREVpq 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FN0_A       168 --AVDTALNGEAYKQQVARAVAEIRRGEYVKVIVSRAIPLPSRIDMPATLLYGRQANTPVRSFMFRQEGREALGFSPELV 245
gi 83769476  166 -hPIDTNTRASEYVEQVEAALADIRAEKYTKVIPSRAVSLPWRVDMPGTLLCGRQHNNPARSFCLRHGNNQAIGFSPELV 244
gi 87251745  187 adILNHEQIQHDYQAMVAAAVKEIVADDYKKVILSRRATLPAAIDIRRSFISGRGKNTPARSFLLKLGELEAFGFSPETV 266
gi 92110317  165 --VVDTALNGEAYKQQVARAVAEIRRGEYVKVIVSRAIPLPSRIDMPATLLYGRQANTPVRSFMFRQEGREALGFSPELV 242
gi 81571246  175 asAVDVVTDPSNYRDRVASAVAEIAAGRYHKVILSRCLQVPFAVDFPSTYRLARRHNTPVRSFLLRLGGIRAVGYSPELV 254
gi 81706979  175 srSVDVSDDPSGFRRRVAVAVDEIAAGRYHKVILSRCVEVPFAIDFPLTYRLGRRHNTPVRSFLLQLGGIRALGYSPELV 254
gi 121712273 169 liDVDTQTDTDSYIARVQRAQTEIAQGLYTKVISSRAVGFTDKVDFPATLLHGRRGNTPARTFCLSHGDKKATGFSPELV 248
3LOG_A       177 srSVDVSDDPSGFRRRVAVAVDEIAAGRYHKVILSRCVEVPFAIDFPLTYRLGRRHNTPVRSFLLQLGGIRALGYSPELV 256
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FN0_A       246 MSVT-GNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCLPGSVVVEDLMSVRQRGSVQH 324
gi 83769476  245 MSLR-DGKVTTEPLAGTRSQEEGGDKSKKLKEALVSDPKEIVEHVLSVKEAINELDRLCSPGTVVVDDLMTVRPRGSVQH 323
gi 87251745  267 LEVDnLGHLSTQPLAGTRFLPADPIEAERLKKELTTDPKEIAEHATSVKLAIEELEQVCEQETVNVAQFMEVSERGSVQH 346
gi 92110317  243 MSVT-GNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQH 321
gi 81571246  255 AAVRhDGVVVTEPLAGTRAFGRGALHDRQARDDLESNSKEIVEHAISVRSSLQEMAEIAEPGTAVVTDFMTVRERGSVQH 334
gi 81706979  255 TAVRaDGVVITEPLAGTRALGRGPAIDRLARDDLESNSKEIVEHAISVRSSLEEITDIAEPGSAAVIDFMTVRERGSVQH 334
gi 121712273 249 LSVK-NGKVTTEPLAGTRSRQGTEKEIAQLRQELLNDPKEIVEHVISVREAVQELKQLCAPDTVIVEDLMSVRERGSVQH 327
3LOG_A       257 TAVRaDGVVITEPLAGTRALGRGPAIDRLARDDLESNSKEIVEHAISVRSSLEEITDIAEPGSAAVIDFMTVRERGSVQH 336
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FN0_A       325 LGSGVSGQLAENKDAWDAFTVLFPSITASGIPKNAALNAIMQIEKTPRELYSGAILLLD-DTRFDAALVLRSVFQDSQRC 403
gi 83769476  324 LGSTVSGALLPGKDAWDAFNILFPSITATGIPKQAALEGIGRLEKHPRELYSGAILLIEdPETWDVALVLRTVFQGREKQ 403
gi 87251745  347 LASRVTGQLAQDKSAWNAFKVLFPAITASGIPKREAIEAITRYEPTSRGLYSGSVLIADqDGFFDAALVLRAAYKRHSLS 426
gi 92110317  322 LGSGVSGQLAENKDAWDAFTVLFPSITASGIPKNAALNAIMQIEKTPRELYSGAILLLD-DTRFDAALVLRSVFQDSQRC 400
gi 81571246  335 LGSTVSGRLGTSNDRMDALEALFPAVTASGIPKAGGVEAILRLDEGPRGLYSGAVVMVSaDGALDAALTLRAAYEHDGKT 414
gi 81706979  335 LGSTIRARLDPSSDRMAALEALFPAVTASGIPKAAGVEAIFRLDECPRGLYSGAVVMLSaDGGLDAALTLRAAYQVGGRT 414
gi 121712273 328 LGSRVAGMLASDKDIWHAFDTLFPSITASGIPKDAAIEAIQRLENQPRELYSGAVLLIEgSETLEAALVLRTVYQCSEKQ 407
3LOG_A       337 LGSTIRARLDPSSDRMAALEALFPAVTASGIPKAAGVEAIFRLDECPRGLYSGAVVMLSaDGGLDAALTLRAAYQVGGRT 416
                        410       420       430
                 ....*....|....*....|....*....|....
2FN0_A       404 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 437
gi 83769476  404 RIQAGAGIVAQSSPGRELTETSEKLASIAPYVIA 437
gi 87251745  427 MLQAGAGIISLSTPDREWQETCEKMACVLDHLIF 460
gi 92110317  401 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 434
gi 81571246  415 WLRAGAGIIEESTPEREFEETCEKLSTLAPYLIA 448
gi 81706979  415 WLRAGAGIIEESEPEREFEETCEKLSTLTPYLVA 448
gi 121712273 408 WIQAGAGILAQSSPQRELIETQEKLASIAPFIMA 441
3LOG_A       417 WLRAGAGIIEESEPEREFEETCEKLSTLTPYLVA 450
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap