Conserved Protein Domain Family
GldD_lipo

?
TIGR03512: GldD_lipo 
gliding motility-associated lipoprotein GldD
Members of this protein family are found a number of Bacteriodetes lineage bacteria, including both species such as Flavobacterium johnsoniae, which possess a poorly understood form of rapid gliding motility, and other species which apparently do not. Mutation of GldD blocks both this motility and chitin utilization in the model species, Flavobacterium johnsoniae. [Cellular processes, Chemotaxis and motility]
Statistics
?
PSSM-Id: 132551
View PSSM: TIGR03512
Aligned: 3 rows
Threshold Bit Score: 284.123
Threshold Setting Gi: 110640049
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500030700   2 RKLILAFIGISFLFSSCKND---VQPKPKAFLALEYPEAKYDQVDIGCPYIFDKNMLAKVap--sRNRIPCWIQLDYENM 76
gi 500932057   4 KILSVTAILLTLTVVSCKDD---VLPKPAGFLRLDYPEAKYVNFENNCPFVFQMNEDAVI-----KGEKDCGFAITYPKM 75
gi 499906287   4 NIFVLSILGLLILVSSCSNEenaFMPKPKGFNKIDLPAHRYDTLTGDYPYTFEYSSIAKIvpdttKTAEPYWIDIYYPEY 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500030700  77 KGSIFITYQPVKNN---LDSLLTDAQKLPLQHTIKADVIEGDVYTNKLHSTYGM-FYEVDGDAASQAQFYLTDSTNHFLT 152
gi 500932057  76 KATIYLTYKPVNGN---IEKLLKDAQKLTYEHVIKADDILEQPYINPEKKVYGM-FYQVDGNAATNSQFYVTDSTKHFIA 151
gi 499906287  84 KANIQITYKKTNNNpktLEEYIKDSHTLANKHNVKAYAIDE--LITDTKNGYAVkVFELSGDVPSQIQFHVTDSTKNFLR 161
                        170       180       190
                 ....*....|....*....|....*....|....*
gi 500030700 153 GSVYFQSLPNFDSIVPAAEYLKKDIRHLMESLRWS 187
gi 500932057 152 GSVYFYAKPNFDSIMPAASYIKNDMQRIMETLKWK 186
gi 499906287 162 GAVYFRTSTKNDSLAPVISYMKEDVMHLIETLKFK 196
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap