Conserved Protein Domain Family
GldC

?
TIGR03515: GldC 
gliding motility-associated protein GldC
Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldC is a protein linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldC do not abolish the gliding phenotype but do impair it. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Statistics
?
PSSM-Id: 132554
View PSSM: TIGR03515
Aligned: 5 rows
Threshold Bit Score: 156.132
Threshold Setting Gi: 5360169
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5360169     5 IKSEIKFNVELDENRVPEKLTWSAQDGGVLAE-EAKAIMLSIWDSKAQETMRIDLWTKDMPVDEMKIFFHQTLVAMADTF 83
gi 499903603   2 KNSEIKFSVTLDDKNIPESILWEATDGPSDKPlPTDAIALSLWDHSQMNTMQINIWTKEMPVEEMKRFAIEGIGGMADSI 81
gi 495512722   2 KKAEIKITVELDDNNVPDNILWESTDAKTQEQvPVKSMMLALWDHNYKNSMRIDLWTKDMPVDEMKRFFYETLQTMGDSF 81
gi 495476062   2 KKSDIKFQIELDEKSLPKAITWDATDKESHGQeSTKSISLNIWDNLNQSTLRIDLWTEEMSMVEMKRFYIDILGGMGQTI 81
gi 488782194   2 RKEDININVTLDDANVCEQILWMATNTPDQGTnGSKAMSLSFWDEDGKGTAKMDLWTKKMEIHEMKAFCIETIAGLADTV 81
                         90       100
                 ....*....|....*....|....*...
gi 5360169    84 KRATDDEKMSDTMKDFCDYFAEKLELTK 111
gi 499903603  82 ENATGDIKMAEMIRDLCKKLVIHVKENA 109
gi 495512722  82 LKATGEKLIIEDLRDYCAHFADKMGIDM 109
gi 495476062  82 LNSTGDEYMSEEIKALCDRLVTHVNEEN 109
gi 488782194  82 RQATNDEAMAMDIDDLCRRLSQRLKQEM 109
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap