Conserved Protein Domain Family
ABC_perm_GldF

?
TIGR03518: ABC_perm_GldF 
gliding motility-associated ABC transporter permease protein GldF
Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldF is believed to be a ABC transporter permease protein (along with ATP-binding subunit, GldA and a sunstrate-binding subunit, GldG) and is linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldF abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Statistics
?
PSSM-Id: 132557
View PSSM: TIGR03518
Aligned: 10 rows
Threshold Bit Score: 281.119
Threshold Setting Gi: 86142999
Created: 9-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91186154    1 MLAIFLKEFNSFFSSAIGFVVAGLFLLATGVLVWVLPGSfNIFDQGYANLTPFFEVLPWIFCVLIPAICMRSFSEEKKQG 80
gi 126577101   1 MKSLFLKEINAFFGSLLGYLILALFLVAIGLIVWVFPES-SVLDYGYADLEPLFTYTPYVFTFLVPAIAMRSIAEERKSG 79
gi 123985083   1 MLTIFKKEFNSFLSSLIAYIVIIVFLTGIGLFMWVFPST-NVLDYGYADLESLFSLAPYVFMFLIPAITMRTFAEEKKTG 79
gi 86142999    1 MFAILKKEFHSFFASPVGYLVIGLFLVLNALFLWVFDNDfNLFDYGFADLTPFFQLVPWIFIFLIPAVTMRSFSDELRLG 80
gi 83848162    1 MYAILKKDIQTFFSSTIGYLVIAVFLIVNGLFLWVFQGDfNVFNYGFAELSSYFRLAPWVLLFLIPAVTMRSIAEERKQG 80
gi 85819823    1 MYPILKKEFTSFFASPIAYLVIGVFLLINGLFLFVFNDDfNILNAGFADVTPFFYLAPWVFLFLIPAITMKSFADEYNTG 80
gi 89516516    1 MKAIYLKELRSYFSSITGYLVIAIFLLVTSLFLFVFDGEfNILNYGFADLSPFFLLVPWLFIFLIPAVTMRSFTIERNLG 80
gi 88784191    1 MFAVFKKEFSSFFSSPVGYLVMGIFLVITGLFLWVFRGPfNIIDYGFADLSLFFLLAPWAFLLLIPAVCMRSFAEERKLG 80
gi 500934482   1 MKSIILREIKSFFGSPIGYLVIAIFLISNGLFLWVFEGDyNILNTGYADLTPFFTLTPWILIFLIPAVTMRSFSDERKQG 80
gi 499904198   1 MWSIFRKEIAVFLNSLIAYLVILVFLTFIGVFMWVLPAS-SILDYGYAEMDTLFSYGPLAFLLLIPAITMRSFAEEKKDG 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91186154   81 TLELLLTKPISINQLIAGKFLGSFSLSVIALLPTLFYIISISALSAEGVQVDYGVIFSSYVGVFLLMSCFTSIGTFASCL 160
gi 126577101  80 TWELLRTSPLSLIQIILVKYLALLFLVILAVIPTLLYFFTIIQLGDPVGNLDQAGFFGSWIGLLMIGSVFASVGLFASSL 159
gi 123985083  80 TMELLFTRPLTDWDILLGKYLASLALVIFALLPTLIYFFSVYCLGNPVGNIDISGTMGSYFGLILLGAVFTSIGLFASVL 159
gi 86142999   81 TLELLLTRPITTLELVLGKFLGALVLLLLALLPTLVYVYAIDQLGNPQGNYDLGILAGSYLGLLFLATAYCAIGVFASTL 160
gi 83848162   81 TLELLLTKPISSMQLILGKYFGALSLIVIAILPTLVYVWTIYALGNPTGNLDLGVILTSYIGMLLLASTFVAIGLFASSV 160
gi 85819823   81 TIELLKTNPISDWKIVLGKFFASLLLVIIAIVPTFTYIFTVYELGNPVGNIDFGSTIGSYLGLLFLASTYTAVGLFTSTL 160
gi 89516516   81 TLEMIFTRPISHRSIIAGKYLAGVTLIIIALIPTILYVYTIGQLGETVNNLDIGSTVGSYAGVLLLVLCYVAIGIFCSSV 160
gi 88784191   81 TLELLLSRPVSTGRLVLGKFLGVCALIGVTLLPTLLYVLAVHQLGATAGNLDTGLVWGSYAGLLLLMGLYAAIGLFASSL 160
gi 500934482  81 TLELLLTKPLSIWQIVNGKFLGSFFLIILAIIPTFIYVKVISSLGSPEGNIDMGSTIGSYFGLLFLIASYSAIGIFTSTL 160
gi 499904198  80 TIELLLTKPLSDWQLLLGKYLSACTLVALALIPTVLYYISVYQLGKPVGNIDSAAVGSSYIGLFLLGCVYTSAGIFASSI 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91186154  161 TDNSLIAFVIGTFLSVLLYFGSVGVSSIpLWDSQLYTLEYFSLSHHFQSISRGILDSRNLIYFISISLFFLVLTHLQLKS 240
gi 126577101 160 TSQQVLAFVLGVFLCFVLYFGFSALADL-QVGNVAYWVEELSLSFHYINLSRGVIDSGDVFFMLGMNWLFLGLSVLTLRN 238
gi 123985083 160 TESQIVSFIIALFLCFLFHEGFGYLANVrDTSDFSYYIVQWGISYHYETIRKGLIDSRNLVYFFSMITVMLLATKLVLGS 239
gi 86142999  161 SENQIVAFLIAVFISFLFYYGFNGIAET----LNIDFLRSLSLQRHFESIGRGVLDSRDLIYFLSVTSVFIALTVFKLES 236
gi 83848162  161 TQNQLVAFIIAVLICFLMFYGFDGISSQ-LINESSFNLSFFGLQYHYDSLGRGVLDTRDLIYFISITVLFIALTHFNIKR 239
gi 85819823  161 SKNQIVAFILSVFITFILFYGFDAIANS--FGSNGFTIQQLGINEHFKSISRGVIDTRDVIYFLSVTFFFLFITKTRLDN 238
gi 89516516  161 TSNQIIAFLLAAVLCFIMYFGFEGFSTV----IENDGISYLGLKYHYESMARGVIDTRDVIYFLSIAILFFALSELSLKI 236
gi 88784191  161 TENQIAAFMLAVAGCFLFYQGFDSLATLfPDGGTALFIRELGIRAHYEAIGQGIVDSRDLLYFISLGVFFLFLTTRRLNA 240
gi 500934482 161 SENQIVAFIIAVFICFLFYFGFEGLASL--VPGQSNIISAFGMQDHFKSMSRGVIDTRDVIYFLSISVLFLSFTVYQLKS 238
gi 499904198 160 STNQIVSFIIALLLCYLIYSGFDHLASLdLWEGSAVTLLPFGLDYHYNALSKGVVDSRNVCYFLTVIGIMLLSTKIILES 239

                 .
gi 91186154  241 N 241
gi 126577101 239 K 239
gi 123985083 240 R 240
gi 86142999  237 K 237
gi 83848162  240 Y 240
gi 85819823  239 E 239
gi 89516516  237 I 237
gi 88784191  241 Y 241
gi 500934482 239 F 239
gi 499904198 240 R 240
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap