Conserved Protein Domain Family
GldJ

?
TIGR03524: GldJ 
gliding motility-associated lipoprotein GldJ
Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldJ is a lipoprotein linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae. Knockouts of GldJ abolish the gliding phenotype. GldJ is homologous to GldK. There is a GldJ homolog in Cytophaga hutchinsonii and several other species that has a different, shorter architecture and is represented by a separate model. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Statistics
?
PSSM-Id: 132563
View PSSM: TIGR03524
Aligned: 3 rows
Threshold Bit Score: 956.327
Threshold Setting Gi: 85821014
Created: 9-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86143911    3 RNLVFKTLVFGLSTMLLVSCGrngKDYKNSSRATGWSIND-RDGGFQANTDyKEQEAAPGLIFIEGGTFTMGRVQDDVMH 81
gi 85821014    1 MKNIFKITFIVFVSLLFVNCK---SSSSNKSRLTGLSFNDpKNGNYIRANSfDGQETPLGMVGVEGGSFTMGQVQDDVMF 77
gi 500932094   5 KIVVLQLMMSMVLMLGTASCSk-kSSSSHASRATGWDVDS-QNGTAARNAG-KKQQAGPGLVFVEGGTFTMGKVQDDVMH 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86143911   82 DWNNTPTQQHVQSFYMDETEVTNLMYLEYLDYLKRVFPPEEANYRNIYYGALPDTLVWRNRLGFNETMTENYLRHPAYAR 161
gi 85821014   78 DWNTTPNKIHVRSFYMDEAEVTNSEYFLYVQYMKDVFPPSEAKYKNIYSSILPDTLVWRKSLGNTDILSENYFRHPAYAD 157
gi 500932094  82 DWNNTPTQQHVQSFYMDETEVTNGMYLEYLEWLKKVFPPTEENYKNIYEGASPDTLVWRNRLGYNETMTNNYLRHPSYAN 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86143911  162 YPVVGVSWIQAVEFSTWRTNRYNEYVLEQEGFTQKGAKYn-VDAQSTFDTDTYLQAPSLTYGGQDDVIRGGKASERREKN 240
gi 85821014  158 YPVVGVSWLQANEYCKWRTNAVNLKTLIDKGNIKNIFDI--DTISNFFDTDVFLVDDSKLFDGDTTVYKRGIGRTVRKRG 235
gi 500932094 162 YPVVGVNWIQAVEFSKWRTDRVNEAVLEKNGYLKKGAKTndVTAESLFNTEAYVASPSTTYGGNEELVLKKNPNGRRPKA 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86143911  241 NTPRPnpnnpgstgeaKDIYVQMK----DGIIStTKYRLPTEAEWEYAALGLVGLREYNVYRGRKKYPWDGAYTRSGNRR 316
gi 85821014  236 EARPA-----------KDAFQGRKitnaDGVLT-QRFRLPTEAEWEFAAKANVENREYNNIRGRKKYAWNGKYTRAKNKR 303
gi 500932094 242 GKDGVvp-------eeKNVYAQRS----SGIIL-PEYRLPTEAEWEYAAAADVGQREYNIYKGQKKYPWSGDYTRSNKRK 309
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86143911  317 NRGDQLANFKQGDGDYGGIAGWSDDNADITAPIKSYEPNDYGLYDMAGNVSEWVADVYRPIVDDEYNDFNYYRGNVYTKN 396
gi 85821014  304 NRGDQLANFKQGKGDYSGPSGWSSDGADIPNEIKSYPPNGFGLYDMSGNVAEWVADVYRPIIDNEANDFNYFRGNLFTKK 383
gi 500932094 310 NRGDQLANFKQGNGDYGGIAGWSDDGADITNAVKSYAANDFGLYDMAGNVAEWVADVYRPIIDNEANDFNYYRGNQYAKN 389
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86143911  397 AITEDGTVKVLTTE---DIVYDTLENGKIVARGLPGEIAQVPVDDEETYLRTQFSESDNRNFRDGDKQSSRYYQsfsD-- 471
gi 85821014  384 MIDSKGNVVFAGEQggaEIEYDTLPNGKVVPRYLPGSIKYVPITKNDATLRRNFSKADNANIGDGDANSTRFYE---Dde 460
gi 500932094 390 KIGKDGKIEIVSTA---TIKYDTLSNGKVVARNLPGEIAQVPVDEQETYLRTNFSTSDNINYRDGDKQSSRYFDf-gDse 465
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86143911  472 -ADSDSDRMYDSPINRI-REGEEG-MIKEYDKENDRTTLVDDEVRVYKGGSWRDREYWLDPAQRRYLPQTMATDDIGFRN 548
gi 85821014  461 dEIARRPSMYNSPKSPTvEIDPVTgREVLVNDDKKRTTLISDRTRVYKGGSWSDREYWLDPAQRRYLPEYMATNYIGFRC 540
gi 500932094 466 sGSKADQAMYNSPKHNI-TTDSLGkMIRKYDNSSKRTTLIDDKVRVYKGGSWRDRAYWLDPAQRRYFPQDMATDYIGFRC 544
                        570
                 ....*....|....*..
gi 86143911  549 AMSRVGSKSTKNKTPRN 565
gi 85821014  541 VTDKLGPLSNGKRKARN 557
gi 500932094 545 AMSRVGAKTERRKSPRN 561
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap