Conserved Protein Domain Family
selenium_YgeY

?
TIGR03526: selenium_YgeY 
putative selenium metabolism hydrolase
SelD, selenophosphate synthase, is the selenium donor protein for both selenocysteine and selenouridine biosynthesis systems, but it occurs also in a few prokaryotes that have neither of those pathways. The method of partial phylogenetic profiling, starting from such orphan-selD genomes, identifies this protein as one of those most strongly correlated to SelD occurrence. Its distribution is also well correlated with that of family TIGR03309, a putative accessory protein of labile selenium (non-selenocysteine) enzyme maturation. This family includes the uncharacterized YgeY of Escherichia coli, and belongs to a larger family of metalloenzymes in which some are known peptidases, others enzymes of different types.
Statistics
?
PSSM-Id: 132565
View PSSM: TIGR03526
Aligned: 5 rows
Threshold Bit Score: 705.792
Threshold Setting Gi: 83590482
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 488322307   3 FNAVNAAAEGYREDMVKFLRDLVKIPGESAEEGNKIARAKAEMEKLGFDKIDIDPQGNLLGYMGSGEKLIAFDGHMDTVG 82
gi 491443383   7 FEMVLEKAYQYKAEMTQFLRDMIAIPSESCDEERVVLRIKQEMEKVGFDKVEIDPMGNVLGYIGHGPHLIAMDAHIDTVG 86
gi 500994471   6 KEEILKLAEKYKPEMSRFLRDMARIPSESCDEKGVILRIKEEMEKVGFDKVEIDPMGNVLGYIGHGKHVIAMDAHIDTVG 85
gi 499501986   2 FNNIKDRSKFYAQNIYDFASTLIQTESFSGDEGRVAQLVAEKMRALDFDKVEIDEMGNVCGSVGHGPKLICVDAHMDVVG 81
gi 499712414   6 IAQIKSEVAKYRGDIIRFLKDIVAIPSPNGDIKAVAERIGQEMRKLGFDDVFLDSMGNIVGRIGSGPRVLLYDSHIDTVD 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 488322307  83 IGEMSNWKFDPYDGYETETEIGGRGTSDQEGGIVSAIYGAKIMKDLGLLsEKYTALVTVTVQEEDCDGLCWQYIIKEDGI 162
gi 491443383  87 VGNMANWTFDPYEGMEDHEIIGGRGASDQEGGMASMVYAGKIIKDLGLE-DEYTLLVTGTVQEEDCDGLCWQYIIEQSKI 165
gi 500994471  86 IGDRNLWNYDPYEGYEDDEIIIGRGVTDQEGGMASMVYAGKIIKDLGLE-DDYTLIVTGTVQEEDCDGLCWQYIVNEDKI 164
gi 499501986  82 YGDEKQWHQSPTSGAQDEKNIYGRGAADMKASIASMLYAGKILKDLDLL-EDFTYMVCTTVQEEPCEGLAWEFLIEKKGL 160
gi 499712414  86 IADSDQWQWDPYKGKEENGIFYGLGAGDEKNSTPGMVYGLKIIKDLGLA-DDFTLYYFGNIEEI-CDGVAPNSLVVTDKI 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 488322307 163 RPEFVVSTEPTDGGIYRGQRGRMEIKVDVKGVSCHGSAPERGDNAIYKMADILQDVRALNNNgdtestairglvRM-LDP 241
gi 491443383 166 RPEFVVSTEPTDCQIYRGQRGRMEIRVEVQGVSCHGSAPERGDNAIFKMGPILGELQELSHN------------LG-NDD 232
gi 500994471 165 KPEFVVITEPTSLNIYRGHRGRMEIKVTTHGISCHGSAPERGDNAIFKMAPILNELKALNEN------------LK-DDE 231
gi 499501986 161 QPDFVILAEPSNDEISLAQKGRMEFKISVSGLSAHASTPHKGKNAIYKMARIITELEQLNDN------------LEiEDP 228
gi 499712414 164 KPDFVVIGEPTKMNIYRGHRGRVEMKVTTKGRTCHASAPERGVNAVYKMAEIIKGISQMGAD------------FV-EDP 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 488322307 242 kynpewqearFLGRGTVTVSQIFHSSPSRCAVADGCTVSLDRRMTAGETWESCLEEIRNLPAVKkyGDDVTVSMYNYDRP 321
gi 491443383 233 ----------FLGKGTLTVSEIFFTSPSRCAVADSCAVSIDRRLTWGETWQGALDEIRALPAVQ--AAGAEVSMYQYDRP 300
gi 500994471 232 ----------FLGKGTLTVSEIFFSSPSRCAVADGCTISVDRRLTDGETWEYAIQQIKNLPSVK--AAKAEVEMYSYERP 299
gi 499501986 229 ----------ELGKGTLVVSEISAHAPSRCSVADYCEISIDRRLTWGESPKYALDQVKQLPAVQ--EAEARVEFFTFSEP 296
gi 499712414 231 ----------FLGKGSIAVTDIHCKTPSINALPDECVIYIDRRLTFGETQEMAVEQVRKVAEPH--G--GKVEVLEFDEP 296
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 488322307 322 SYTDLTYEIECYFPTWVIPENHDVTKALMETHKNLYGETrkgsvetvemreerPLLDKWTFSTNGVSIMGRNGIPCIGFG 401
gi 491443383 301 AYTGLVYPTECYFPTWKVEEDHITVKTLSKAYTQLFNKA--------------PVVDKWTFSTNGVSIMGRHGIPVIGFG 366
gi 500994471 300 SYTDLVYPTECFFPTWVLKEDHPICETAVKCYKDLFKSE--------------PKVDKWTFSTNAVSIMGRYGIPCIGFG 365
gi 499501986 297 SYTGKPCQKECIFPAWKLEKEHRITKSALMAYRELFAKE--------------GTLTTWPFSTNGVGIMGKHQIPVIGYG 362
gi 499712414 297 SYTGFVFKVDKYFPAWVLPEDHLLVKAGLETYQRVFGQP--------------TGVGKWVFSTNGIYWMGKAGIPAIGFG 362
                        410       420       430
                 ....*....|....*....|....*....|....*
gi 488322307 402 PGAEAQAHAPNEKTWKDDLVRCAAVYAALPTVYCG 436
gi 491443383 367 PGKEPEAHAPNEKTWKEHLVKCAAMYAVIPMLYLA 401
gi 500994471 366 PGHEDQAHAPNERTWKEELVKAAAMYALIPITYVK 400
gi 499501986 363 PGTLDACHVPNEYVAKEQVLKATQMYAAIPIIYLQ 397
gi 499712414 363 PGDEVYAHSVLDQVPIEDVVRSTEFYAYFPTVlre 397
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap