Conserved Protein Domain Family
DapD_Ac

?
TIGR03532: DapD_Ac 
2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase
This enzyme is part of the diaminopimelate pathway of lysine biosynthesis. Alternate name: tetrahydrodipicolinate N-acetyltransferase. Note that IUBMB lists this alternate name as the accepted name. Unfortunately, the related succinyl transferase acting on the same substrate (EC:2.3.1.117, TIGR00695) uses the opposite standard. We have decided to give these two enzymes names which more clearly indicated that they act on the same substrate.
Statistics
?
PSSM-Id: 132571
View PSSM: TIGR03532
Aligned: 7 rows
Threshold Bit Score: 356.756
Threshold Setting Gi: 24378817
Created: 9-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499549766   6 ANEIISFIQNSKKSTPVKVYIKGDLEGIDFGSSAKTFITGNVGVVFGEWQDIQAAIEANQDKIEDYVVENDRRNSAIPLL 85
gi 489737439   6 AQSIINYIGSAKKKTPVKVYVKGALDQLNVPAGIKTFFSGNAGVLFGDWADVEPFLKANAANIEDYELENDARNSAVPMA 85
gi 489642438   6 AKSIIEYIGNAPKKTPVKVFIKGNLDQLNFPNTIENFTEQHSGIIFGDWKDVEPFLNDNKEKIVQYRIENDVRNSAVPLI 85
gi 500994678   8 PYEIARYIKEAKKSTPIKAYIEGDLSNCDF-TNIEKFNSGDLYILFGESEEILVIIEKNKDKIKNCRIEQDRRKSAIPLL 86
gi 488415663   7 AQEIIQYISDAKKSTPLKVYVNGHFENVTFPESFKVFGSEHSKVIFCEANEWKQFYQQNHSLITELEIEMDRRNSAIPLK 86
gi 497295653  13 AYEIARYIKEAKKSTPVKAYVQGKI-QVEEEEGLKIFGSEDFKILIGELEVVEKVIEQNKDRIKYYHLEYDRRNSAIPLL 91
gi 488196169   8 AQEIIAFIGNAEKKTNVKVTFEGAL-AAALPENVVKLGN----VLFGDWKDIEPLL-ANLTENKDYVVEQDGRNSAVPLL 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499549766  86 DLKGIKARIEPGAIIRDHVEIGDNAVIMMGAVINIGAVVGEGTMIDMNAVLGGRATVGKNCHIGAGAVLAGVIEPPSAKP 165
gi 489737439  86 DLKQYNARIEPGAIIRDQVLIGDNAVIMMGAVINIGAEIGEGSMIDMGAILGGRAIVGKNCHIGAGTVLAGVVEPPSAKP 165
gi 489642438  86 DLKKFNARIEPGAIIRDQVAIGKNAVIMMGAIINIGAEIGDDTMIDMGVVLGGRAIVGKHCHIGAGSVLAGVIEPASAKP 165
gi 500994678  87 DMLKINARIEPGATIRDKVIIGENAVIMMGAVVNIGAEIGEGTMVDMNAVVGARGKLGKNVHLGAGAVVAGVLEPPSSDP 166
gi 488415663  87 DLTNTNARIEPGAFIREQAIIEDGAVVMMGATINIGAIVGEGTMIDMNATLGGRATTGKNVHVGAGAVLAGVIEPPSASP 166
gi 497295653  92 DITHLDARIEPGAIIRDKVKIGKNAVIMMGAVINIGAEIGENSMIDMNAVIGARGIIGKNVHVGAGAVIAGVLEPPSSVP 171
gi 488196169  82 DKRNINARIEPGAIIRDQVTIEDNAVVMMGAIINIGAEIGEGTMIDMGAILGGRATVGKNSHIGAGAVLAGVIEPASADP 161
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 499549766 166 VVIEDDVLVGANAVILEGVTVGKGAVVAAGAVVVEDVPPYTVVAGVPARVIKQIDEQTRAKTEIKQELRQL 236
gi 489737439 166 VQIDDDVLIGANAAVLEGVHVGKGAVVAAGAIVIEDVAPNTVVGGVPARKLKDIDDKTKSKTELMAELRNL 236
gi 489642438 166 VQIDDDVVIGANAVVIEGIHVGKGAVIAAGAIVTKDVEPYTMVAGVPAKVIKKVDNKTLDKTGLEDDLRKI 236
gi 500994678 167 CTIEDNVLIGANAVILEGVKIGKGSVVAAGSIVTTDVPENVVVAGAPAKIIKEVDVKTKDKTKLLDDLRK- 236
gi 488415663 167 VVIEDNVLIGANAVILEGVRVGAGAIVAAGAIVTQDVPAGAVVAGTPAKVIKQTSEVQDSKREIVSALRKL 237
gi 497295653 172 VVIEDNVMIGANAVILEGVRVGRGAVVAAGSVVIEDVPPNTVVAGVPAKIVKVVDEKTREKTKLMEDLRG- 241
gi 488196169 162 VRIGDNVLVGANAVIIEGVQVGSGSVVAAGAIVTQDVPDNVVVAGVPARVIKEIDEKTQQKTALEDALRNL 232
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap