Conserved Protein Domain Family
TIGR03549

?
TIGR03549: TIGR03549 
YcaO domain protein
This family consists of remarkably well-conserved proteins from gamma and beta Proteobacteria, heavily skewed towards organisms of marine environments. Its gene neighborhood is not conserved. This family has an OsmC-like N-terminal domain. It shares a YcaO domain, frequently associated with ATP-dependent cyclodehydration for peptide modification. The function is unknown. Fifteen of the first sixteen members of this family are from selenouridine-positive genomes, but this correlation may not be meaningful.
Statistics
?
PSSM-Id: 132588
View PSSM: TIGR03549
Aligned: 7 rows
Threshold Bit Score: 1418.05
Threshold Setting Gi: 92112170
Created: 9-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499838513   2 EIKVDFLDKLRLEAKFDDFTVIADQPIRYKGDGSAPGPFDYFLASSALCAAYFVKVYCVARNIPTDNIRLSQNNIVDPEN 81
gi 499906627  22 EINVNFLDNLRLEAKFDDFTVITDQPIRYKGDGSAPSPFDYFLASSAMCAAYFVKVYCKARDIPTDNIRLSQNNIVDPED 101
gi 499554625   2 EINVNFLDNMRLEAKFDDFTVISDQPIRYKGDGSAPGPFDYFLASSVMCAAHFIRLYCDARDIPTENIRVSQNNVVDPED 81
gi 499353686   2 EIKVNFLDNLRLEAKFDDFSVIADQPIRYKGDGSAPGPFDYFLASSAMCAAYFVKVYCNSRDIPTENIRLSQNNIVDPED 81
gi 499814544   2 EIKVNFLDNLRLEAKFDDFTVTADQPIRYKGDGSAPSPFDYFLASSALCAAYFIKVYCKARDISTENIKLSQNNIVDPED 81
gi 489348919   2 EIKVNFLDNLRLEAKFDDFTVIADQPIRYKGDGSAPGPFDYFLASSALCAAYFVKLYCQTRDIPTENIRLSQNNIVDPEN 81
gi 499824611   2 EIKVNFLENLRLAAKFDDFTVETDQPIRYKGDGSAPSPFDYFLASSALCAAYFVRLYCNARDIPTENIRLSQNNIVDPEN 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499838513  82 RYQQIFKIQVELPADISAKDRQGILRSIDRCTVKKVVQTGPEFVIEEVENLDADAQSLLTLKP----ASGASTYISGKDL 157
gi 499906627 102 RYNQIFKIQVELPEDISDKDRQGILRSIDRCTVKKVVQTGPDFQIEQVDSLTEDAQALLMVEP----DEAHRTFIEGKDL 177
gi 499554625  82 RYKQLFKIQVELPADISEKDRKAIIRAAERCAVKRVIENDLEFDVEAVESITQDAQALLTIRP----DSDSRTYIEGKDL 157
gi 499353686  82 RHNQIFQIQVELPESISEKDKKGILRSIDRCTVKKVVQQGPEFKVEAVTSLEDDAQAMLMQQP----DDGVSTFILGKDL 157
gi 499814544  82 RYNQIFQIQVELPDDISDKDREGILRSIDRCTVKKVIQTGPEFNVETVENLSADANAMLMGSS----DQDASTFILGKDL 157
gi 489348919  82 RYNQIFKIQVELPEDISDKDRQGILRSIDRCTVKKVVQTGPEFVIEVVDNLDADAQGLLMPVS----DT--STYIPGKDL 155
gi 499824611  82 RYNQIFKIQVELPEDLSEKDRTGILRAAERCSVKRVIQNAPEFQIETVENIDEDAQALLMGTNakdgDAGGETWIEGKDL 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499838513 158 PLEQTIANMSGILAGLGMKIEIASWRNIVPNVWSLHIRDAHSSMCFTNGKGATKESALASALGEFIERLNCNHFYAGTFW 237
gi 499906627 178 PLEQTIANMTAILAKLGMKIEIASWRNIVPHVWSLHVRDAASPMCFTNGKGATKEAALCSALGEFIERLNCNFFYNDQFF 257
gi 499554625 158 PLEQTIANMTAILADLGMKIEISSWRNIVPHVWSLHIRDAASPMCFTNGKGATKESALCSALGEFIERLSCNFFYNDQYF 237
gi 499353686 158 PLEETIANMSKLLADLGMKIEISSWRNIVPNVWSLHIRDAASPMCFTNGKGATKESALASALGEFIERLNCNFFYNDQFF 237
gi 499814544 158 PLEQTIANMTAMLAELGMKIEISSWRNIVPNVWSLHIRDAASPMCFTNGKGASKESALCSALGEFIERLNNNFFYNDQFF 237
gi 489348919 156 PLEQTIANMSGILAGLGMKIEIASWRNIVPNVWSLHVRDAQSPMCFTNGKGATKEAALASALGEFIERLNCNFFYNDQFW 235
gi 499824611 162 PLERTIANMTRILEDLGMKIEIASWRNIVPNVWSLHLRDAASPMCFTNGKGATKEAALCSALGEFIERLSCNFFYNDQFF 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499838513 238 GEDLANAAFVHYPNERWFKPGRKDALPVEILDEYCLPIYNPDGELRGSHLYETNSGNVQRGICSLPFVRQSDGEVVYFPS 317
gi 499906627 258 GEEIANSNFVHYPNEKWFKPGPNDALPEGILDDYCLGIYNPEGELGGSNLIDTNSGRADRGICSLPFVRQSDGETVYFPS 337
gi 499554625 238 GEEIANAEFVHYPNEKWFKPGTNDELPTEILDEYCRELYDPEGELRGSHLIDTNSGRADRGIVSLPFTRHSDGETVYFPS 317
gi 499353686 238 GTDIATSDFVHYPNEKWFKAGADDALPSDILDDYCLAIYNPDDELRASNLIDTNSGMTERGICSIPYVRQSDSETVYFPS 317
gi 499814544 238 GTEIANSEFVHYPNEKWFPLEDDDALPAGMLDDYCLEIYNQDDELQGSHLIDTNSGNRERGICAIPYKRKSDGQTVYFPS 317
gi 489348919 236 GEDLANAPFVHYPNEQWFKPGPRDALPAEILDEHCLAIYNPDGELRGSHLYDTNSGNTARGICSLPFVRQSDQQVVYFPS 315
gi 499824611 242 GEAIADSAFVHYPSERWFPLEDDDALPAGLLDAHCRAIFDPDGELRGSHLIDTNSGRKDRGIVALPFKRRSDGETVYFPS 321
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499838513 318 NLVENLYASNGMSAGNTLAEAQVQCLSEIFERAVKREILEGEMALPDVPQEVLAKYPGIMAGIQVLEEQGFPILVKDASL 397
gi 499906627 338 NLIENLFLSNGMSAGNTLAEAKVQCLSEIFERAVKKHIIEEEIALPDVPQEVLAKYPGIVEGITALEEQGFPVLVKDASL 417
gi 499554625 318 NLIENLYLSNGMSAGNTLPEAQVQCLSEIFERAVKKHIIEEEIALPDVPQEVLNKYPNILEGIKALEEQGYPVLVKDASL 397
gi 499353686 318 NLIENLFLSNGMSAGNNLPEAQVQCLSEIFERAVKKQIIAEEIVLPDVPKDVIAKYPAILAGIEGLEAQGFPVVVKDASL 397
gi 499814544 318 NLIENLFLSNGMSAGNNLQEAEVQCLSEIFERAVKRQIIEQEIVLPDVPMSVLEKYPSILAGIKGLEEQGFPIVVKDASL 397
gi 489348919 316 NLIENLFLSNGMSAGNTLAEAQVQCLSEIFERAVKREILEGELCLPDVPQEVLAKYPAILAGIQGLEEQGFPVLVKDASL 395
gi 499824611 322 NLIENLYLSNGMSAGNTLAEAEVQCLSEIFERAVKKEIIEQEIVLPDVPEEVLAKYPGIQEGIAALEAQGFPVLVKDASL 401
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499838513 398 GGIYPVMCVTLMNPRTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDLPRPSFVSNAVTEPNNFVEHFIDSSGVVS 477
gi 499906627 418 GGQFPVMCVTLMNPRTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDLPPPTFNSQEVCEPNNFVEHFIDSSGVVS 497
gi 499554625 398 GGQFPVACVTLMNPRTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDLPAPTFNSMAVTEPNNFVEHFIDSSGVVS 477
gi 499353686 398 GGKFPVMCVTLMNPKTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDVPKPTFNSMAVTEPENFVDHFIDSTGVVS 477
gi 499814544 398 GGQFPVMCVTLMNPRTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDVPKPTFNSMAVTEPENFVEHFIDSTGVIS 477
gi 489348919 396 GGEFPVMCVTLMNPRTGGVFASFGAHPSLEVALERSLTELLQGRSFEGLNDLPQPTFESHALTEPNNFVEHFIDSSGVVS 475
gi 499824611 402 GGRYPVMCVTLMNPRTGGVFASFGAHPSFQVALERSLTELLQGRSFEGLNDLPQPTFSSLAVSEPNNFVEHFIDSSGVIS 481
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499838513 478 WRFFSAKSDFDFVEWDFSGqgknSNTEEAATLLSILEGMGKEVYMAVYDQLGSVACRILVPGYSEVYPVEDLIWDNTNKA 557
gi 499906627 498 WRFFSAQADESFCEWDFSG----TTEEESARLFGILESLEKEAYVAVYEELGAPVCRILVPDFSEVYPVEDLVWDNTNMA 573
gi 499554625 478 WRFFSAKSDIEFVEWDFSG----SNQEEADTLFGILQDMGKEAYIAVHEDLGAPVCRILVPGYSEVYPVEDLIWDNTNIA 553
gi 499353686 478 WRFFSAKHDYEFVEWDFSG----TNEEENAGLMDILKDLDKEVYIAEFNQLGATACRILVPDYSEVYPVEDLIWDNTNKS 553
gi 499814544 478 WRFFSSKHDYDFCEWDFSG----TSEEEAKGLFAILEAMGKEVYIAEFTELGASACRMLVPDYSEVYPVDDLIWDNTNKA 553
gi 489348919 476 WRFFSAKADFEFVEWDFSGhgedSNQQEAATLFGILEDLGKEVYMAVYDNLGATACRILVPGYSEIYPVEDLIWDNTNRA 555
gi 499824611 482 WRFFSDRTDLDFHEWDFAG----TTAEEAERLYGLLADQGLEAYVMEHEDLGAPVCRILVPGYSEVYPVEDLVWDNTNMA 557
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499838513 558 LSFRADILNLHRLDDESLEALLERLDNSELDEYADIATLIGIEFDENTDWGQLTVLELKLLIHLALQQFEAAHELVGAFL 637
gi 499906627 574 LDYREDILNLHRLSDEQLSQLVERLEESQIDNYTDIITLIGIEFDENTVWGQLTILELKLLIYLALQRHEDALELVDMFI 653
gi 499554625 554 LQYREDILNLHRLTDDQLEDLVERLEDSQLDNYMDIITLIGIEFDENTVWGQLTILELKLLIYLALQRHDDAFEYVEMFL 633
gi 499353686 554 LDYREDILNLHRLDDEALTGLFDRLEESQQDNYIDIRTLIGIEFDENTVWGQLTILELKILICLALGALEDATELVGEFL 633
gi 499814544 554 LLYREDILNLHSLSTKALVKLVNRLEESQLDNHTDIRTLIGIVFDENTVWGKLTIIELKIMIYLALGSHEDAIELVGEFL 633
gi 489348919 556 LSFRADILNLHSLDSRSLKLLLKRLDNCDVDDYTTITTLIGVEFDENTVWGQLTILELKLLICLAVQRFEDAKELVEAFL 635
gi 499824611 558 LDFRADILHLHTLEDERLADLLERLEESQLDDHIKVGTLIGIEFDDNTVWSELTILELKLLIELALGEYEAALEHVQMFL 637
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499838513 638 QYNDNTLERGLFYQALDVVLEVLLDDDLDLEDYKVNFRRMYGNARMDAVLGSVDGSVRFFGLTPTSMKLEGLDRHHRLID 717
gi 499906627 654 QFNDNTVERGLFYRAVNAVLEITLDEELSLDDYRTNLGRMYGEDTLETVIGAVEGSLRFPGLTPTNMQLEGLEKHQRLIE 733
gi 499554625 634 QFNDNTVERTLFYRAIEAVLEITLDEELELDDYRYNLGRMYGEETIEAVIGSVNGTTRFYGLTPTNMQLEGLDRHLRLIE 713
gi 499353686 634 QYNDNTVERGLFYQAVHAVLEVTLDEEMELEDYLGNFNRMFGAENMEQVVGSVYGEVRFYGLTPTSMKLEGLDKHLRLIE 713
gi 499814544 634 QFNDNTVQRGLFYQAVSAVLEVTLDEDLELEHFIESFNRMYGKDVMDNVVGSVNGTVRFYGLTKTSMQLEGIEPHLRLIE 713
gi 489348919 636 QFNDNTVDRGLFYQALNVVLEVQLDDELEMDDYEANFRRMFGNARMDAVLGSVDGSVRFHGLTPTSMKLEGLDRHLRLID 715
gi 499824611 638 QFNDNTVQRGLFHQAMQAVLEIALDDDLDFNDYHRNLTRMFGEETMRQVIGAVNDEIRFPGLTPTSMGLEGIDRHQRLIE 717

                 ....*.
gi 499838513 718 SYKKLH 723
gi 499906627 734 SYKKLH 739
gi 499554625 714 SYKKLH 719
gi 499353686 714 SYKKLH 719
gi 499814544 714 SYKKLH 719
gi 489348919 716 SYKKLH 721
gi 499824611 718 SYRKLH 723
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap