1EZW,1Z69,1F07


Conserved Protein Domain Family
F420_mer

?
TIGR03555: F420_mer 
Click on image for an interactive view with Cn3D
5,10-methylenetetrahydromethanopterin reductase
Members of this protein family are 5,10-methylenetetrahydromethanopterin reductase, an F420-dependent enzyme of methanogenesis. It is restricted to the Archaea. [Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 132594
View PSSM: TIGR03555
Aligned: 8 rows
Threshold Bit Score: 557.904
Threshold Setting Gi: 13787047
Created: 9-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1EZW_A        6 FGIELLPDDKPTKIAHLIKVAEDNGFEYAWICDHYNNYSYMGVLTLAAVITSKIKLGPGITNPYTRHPLITASNIATLDW 85
gi 38604646   3 FGIEFVPNEPIQKLCYYVKLAEDNGFEYCWITDHYNNRNVYMALTAIAMNTNKIKLGPGVTNPYVRSPAITASAIATLDE 82
gi 38604640   3 FGIEFVPNEPIEKIVKLVKLAEDVGFEYAWITDHYNNKNVYETLALIAEGTETIKLGPGVTNPYVRSPAITASAIATLDE 82
gi 38604641   3 FGIEFVPDMKYYELEYYVKLAEDSGFDYTWITDHYNNRNVYSMLTILALKTRTIKLGPGVTNPYHISPALTASAIGTINE 82
gi 38604673   3 FGIEFVPSDPALKIAYYAKLSEQQGFDYVWITDHYNNRDVYSTLTVLALNTNSIKIGSGVTNSYTRNPAITASSIASIAE 82
gi 38604675   6 FGIELLPDDKPTKIAHLIKVAEDNGFEYAWICDHYNNYSYMGVLTLAAVITSKIKLGPGITNPYTRHPLITASNIATLDW 85
1Z69_A        3 FGIEFVPSDPALKIAYYAKLSEQQGFDHVWITDHYNNRDVYSTLTVLALNTNSIKIGPGVTNSYTRNPAITASSIASIAE 82
1F07_A        3 FGIEFVPNEPIEKIVKLVKLAEDVGFEYAWITDHYNNKNVYETLALIAEGTETIKLGPGVTNPYVRSPAITASAIATLDE 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1EZW_A       86 ISGGRAIIGMGPGDKATFDKMGLPFpckipiwnpeaedeVGPATAIREVKEVIYQYLEGGPVEYEGKYVKTGTADVKARS 165
gi 38604646  83 LSGGRAVLGIGPGDKATFDALGIEW--------------VKPVTTLKESIEVIRKLLAGERVSYEGKVVKIAGAALAVKP 148
gi 38604640  83 LSNGRATLGIGPGDKATFDALGIEW--------------VKPVSTIRDAIAMMRTLLAGEKTESGAQL-------MGVKA 141
gi 38604641  83 ISGGRAVLGIGAGDKVTFERIGITW--------------EKPLKRMREAVEIIRQLTEGKAVKYDGEIFKFNGAKLGFKP 148
gi 38604673  83 ISGGRAVLGLGPGDKATFDAMGIAW--------------EKPLATTKEAIQAIRDFIAGKKVSMDGEMVKFAGAKLAFKA 148
gi 38604675  86 ISGGRAIIGMGPGDKATFDKMGLPFpckipiwnpeaedeVGPATAIREVKEVIYQYLEGGPVEYEGKYVKTGTADVNARS 165
1Z69_A       83 ISGGRAVLGLGPGDKATFDAMGIAW--------------KKPLATTKEAIQAIRDFISGKKVSMDGEMIKFAGAKLAFKA 148
1F07_A       83 LSNGRATLGIGPGDKATFDALGIEW--------------VKPVSTIRDAIAMMRTLLAGEKTESGAQL-------MGVKA 141
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1EZW_A      166 IQGSdIPFYMGAQGPIMLKTAGEIANGVLVNASNPKDFEVAVPKIEEGAKEAGRSLDEIDVAAYTCFSIDKDEDKAIEAT 245
gi 38604646 149 IQKA-VPVYMGAQGPKMLETAGMIADGVLINASNPKDFEAAIPLIKKGAEAAGRSMDEIDVAAYACMSVDKNADKAKQAA 227
gi 38604640 142 VQEK-IPIYMGAQGPMMLKTAGEISDGALINASNPKDFEAAVPLIKEGAESAGKSLSDIDVAAYTCCSIDEDSAAAANAA 220
gi 38604641 149 --GS-IPIYIGAQGPKMLQLAAELGDGVLINASHPKDFEVAKENIDAGLAKAGKSRDAFDTVAYASMSVDKDRDKARNAA 225
gi 38604673 149 --GN-VPIYMGAQGPKMLELAGEVADGVLINASHPKDFEVAVEQIRKGAEKVGRDPSEVDVTAYACFSIDKDPAKAINAA 225
gi 38604675 166 IQGSdIPFYMGAQGPIMLKTAGEIADGVLVNASNPKDFEVAVPKIEEGAKEAGRSLDEIDVAAYTCFSIDKDEDKAIEAT 245
1Z69_A      149 --GN-IPIYMGAQGPKMLELAGEIADGVLINASHPKDFEVAVEQIKKGAEKAGRDPSEVDVTAYACFSIDKDPVKAVNAA 225
1F07_A      142 VQEK-IPIYMGAQGPMMLKTAGEISDGALINASNPKDFEAAVPLIKEGAEAAGKSIADIDVAAYTCCSIDEDAAAAANAA 220
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1EZW_A      246 KIVVAFIVMGSPDVVLERHGIDTEKAEQIAEAIG----KGDFGTAI-G-LVDEDMIEAFSIAGDPDTVVDKIEELLKAGV 319
gi 38604646 228 VPVVAFIAAGSPPVVLERHGIDMEKVEAIRNALK----SGNFPEAF-K-NVDDTMLEAFSIYGTPEDVVEKCKKLAEMGV 301
gi 38604640 221 KIVVAFIAAGSPPPVFERHGLPADTGAKFGELLG----KGDFGGAI-G-AVDDALMEAFSVVGTPDEFIPKIEALGEMGV 294
gi 38604641 226 RIVVAFIVAGSPPTVLERHGLSEDAVNAVREALNnaftKGDWGGVA-K-SVTDEMIDIFSISGTPDDVIERINELSKAGV 303
gi 38604673 226 KVVVAFIVAGSPDLVLERHGIPVDAKKQIGDAIA----KGDFGALM-GgLVTPQMIEAFAICGTPEDCMKRIKDLEAIGV 300
gi 38604675 246 KIVVAFIVMGSPDVVLERHGIDTEKAEQIAEAIG----KGDFGTAI-G-LVDEDMIEAFSIAGDPDTVVDKIEELLKAGV 319
1Z69_A      226 KVVVAFIVAGSPDLVLERHGIPVEAKSQIGAAIA----KGDFGALMgG-LVTPQMIEAFSICGTPDDCMKRIKDLEAIGV 300
1F07_A      221 KIVVAFIAAGSPPPVFERHGLPADTGKKFGELLG----KGDFGGAI-G-AVDDALMEAFSVVGTPDEFIPKIEALGEMGV 294
                       330       340
                ....*....|....*....|....*.
1EZW_A      320 TQVVVGSPIGPDKEKAIELVGQEVIP 345
gi 38604646 302 TQIVAGSPIGPNKETAIKLIGKKVIP 327
gi 38604640 295 TQYVAGSPIGPDKEKSIKLLG-EVIA 319
gi 38604641 304 TQVVAGSPIGPDKKKSIQLIGKEIIP 329
gi 38604673 301 TQIVAGSPIGPEKEKAIKLIGKEIIA 326
gi 38604675 320 TQVVVGSPIGPDKEKAIELVGQEVIP 345
1Z69_A      301 TQIVAGSPIGPAKEKAIKLIGKEIIA 326
1F07_A      295 TQYVAGSPIGPDKEKSIKLLG-EVIA 319
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap