Conserved Protein Domain Family
perox_SACOL1771

?
TIGR03563: perox_SACOL1771 
peroxiredoxin, SACOL1771 subfamily
This protein family belongs to the OsmC/Ohr family (pfam02566, OsmC-like protein) of peroxiredoxins.
Statistics
?
PSSM-Id: 132602
View PSSM: TIGR03563
Aligned: 7 rows
Threshold Bit Score: 210.402
Threshold Setting Gi: 379325634
Created: 9-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499379860   4 HHFYLKAEWPGGRNSQGTIDAGNLKTKISIPTEMDGPGIGSNPDEMLLGAAATCYVITLAAMIERAELPLSKMSLESEGI 83
gi 489337968   4 HHFYLKANWPGNRNDVGTIESGNLITSISIPKEMDGPGEGTNPDEMLLGAAATCYIITLAAMMERSGLEKEDLQMESEGI 83
gi 489274331   4 HHFYLQADWPGKRNDIGRIESGNLKTEISIPKEMDGPGAGTNPDEMLLGAAATCYIITLAAMMERSGLEKESLTMESEAV 83
gi 499566178   3 HQFLLDATWNGGRNSTGTIQTGNLSHSISIPKEMGGPGIGTNPDEMLLGAAATCFLITYAAMLERAQIEVESLTLHAEAD 82
gi 499594768   4 HDFKVQTKWRGGREEVGTVNGDIISEQISIPAPLGGNGVGTNPDELLVSAASSCYIISLAATLERAKFTDINLINNSVGT 83
gi 489223181   4 HLFNSHIDWVGGRNSIGDLQAGALNEKISIPKTMDGPGVGTNPDEMLLGAASTCYSITLAAMLERNDILLEHLKVDAKGI 83
gi 488413635  58 HEFKVQTNWNGGRDTVGNLQGDILEEQISIPSGLGGNGTGTNPDELLVSAASSCYIISLAAVLERSGFTDIKIAQSSIGT 137
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 499379860  84 VDVTNGVFTYEKIIHKPFVDLKNEASDKQWNHVRKLVEKAETSCMISRAIQGNVQIEL 141
gi 489337968  84 VNVTKGVFTYKKIIHRPSVVLKHDASQDDVALAHKLCKKAESSCMISRAIQGNVELQL 141
gi 489274331  84 VDVTGGVFTYEKIIHRPLIRLPKEAAQKEAELAERLAKKAETSCMISRAVQGNVAIEL 141
gi 499566178  83 VDVTNNIFEFRAIRHFPTVVLKE---QTQLEKAERLAFKAESSCMITKAVAGNVAVSV 137
gi 499594768  84 ALFENGKFKMVTITHYPKISVTAEDKENLEKRLPKLLEIADNNCMISNSIRNNVEIKI 141
gi 489223181  84 VDVTKGTFTYEKITYHVAMKLTKE---SDEVKAIKLAKRAESSCMISRAIQGNIELET 138
gi 488413635 138 AIFENAKFRMDNIVHYPEIYVSQEQKDNLTKKLPKLLKVADNNCMISNSLRGNVEVKI 195
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap