Conserved Protein Domain Family
WbuZ

?
TIGR03572: WbuZ 
glycosyl amidation-associated protein WbuZ
This clade of sequences is highly similar to the HisF protein, but generally represents the second HisF homolog in the genome where the other is an authentic HisF observed in the context of a complete histidine biosynthesis operon. The similarity between these WbuZ sequences and true HisFs is such that often the closest match by BLAST of a WbuZ is a HisF. Only by making a multiple sequence alignment is the homology relationship among the WbuZ sequences made apparent. WbuZ genes are invariably observed in the presence of a homolog of the HisH protein (designated WbuY) and a proposed N-acetyl sugar amidotransferase designated in WbuX in E. coli, IfnA in P. aeriginosa and PseA in C. jejuni. Similarly, this trio of genes is invariably found in the context of saccharide biosynthesis loci. It has been shown that the WbuYZ homologs are not essential components of the activity expressed by WbuX, leading to the proposal that these to proteins provide ammonium ions to the amidotransferase when these are in low concentration. WbuY (like HisH) is proposed to act as a glutaminase to release ammonium. In histidine biosynthesis this is also dispensible in the presence of exogenous ammonium ion. HisH and HisF form a complex such that the ammonium ion is passed directly to HisF where it is used in an amidation reaction causing a subsequent cleavage and cyclization. In the case of WbuYZ, the ammonium ion would be passed from WbuY to WbuZ. WbuZ, being non-essential and so similar to HisF that a sugar substrate is unlikely, would function instead as a amoonium channel to the WbuX protein which does the enzymatic work.
Statistics
?
PSSM-Id: 132611
View PSSM: TIGR03572
Aligned: 13 rows
Threshold Bit Score: 317.289
Threshold Setting Gi: 37678503
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499477524   1 MLRPRIIPCLLVK--------DGGLVK-TVKFKDPK--YVGDPINAVKIFN----EKRADELIVVDIDATVNGV--EPNY 63
gi 489204348   1 MVRRRVIPCLLLK--------DRGLVK-TVKFKEPK--YVGDPINAIRIFN----EKEVDELILLDIDASRLNQ--EPNY 63
gi 499248946   2 MSNVRLIARLDIK--------GPNLIK-GVHLEGLR--VVGNPNEYAMAYY----AQGADELIYMDTVASLYGR--NNLS 64
gi 499717850   1 MLKKRIIPMLLLS--------QGRMVK-GKQFSAFR--DTGDPVSAARIYN----AQFADELVFLDVDANRQGSdfEQLL 65
gi 499634871   1 MLKKRLIPKFLLR--------DGRLVKyTCFFDNER--IAGNPVTTAKVYN----DYGVDELIVLDIVPSAASR--ARVE 64
gi 499484387   1 MYRNRIIPCLLLK--------DERLVK-TVKFKDPN--YIGDPLNAVRIFN----DKEADELFFIDISASKRE---SINF 62
gi 488878349   1 MLKTRIIPCVLLK--------NGQLVK-SIEFKDFR--TIGHLTSTMRIYN----ARNVDELIILDIDASKSG---EIDF 62
gi 499937427   1 MRNLRIIPRLDIK--------SGTLIK-GVQMEGWR--KVGDPILAAKRYS----EYGADELLFMDVVASLYER--NTLH 63
gi 499442015   1 MLKKRLIPKLQFSikpsyrgpKPVLVI-TRQFDSKR--AIGDPVSQAKIYE----AQLADELVLVDLEGTSDSW--PILL 71
gi 499439846   1 MSKKRIIFVLLYC--------DGFFCL-SRNFKLQR---IGDFRWLQRNYNfnysATFIDELIILDISRKSRDI--NKFA 66
gi 499734847   1 MRRLRIIPVLLLD--------GTSAVK-THQFKPAR--YIGDIVNAAQIFN----SKMADELIVVDIGYHQDN---PSRP 62
gi 500033323   1 MRRIRVIPTLLLK--------EGRLVK-TVRFNQAKatYVGDPVNTAKIFN----DKEVDELAVLDISASRRGA--EPDF 65
gi 499462147   4 MLKIRLIPCIVTK--------GELVVQ-SFAFKNYL--PIGNVKTAIDFFV----NWDVDEIIVNDIDASKEFR--EPNV 66
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499477524  64 KMISNLAMECRMPLCYGGGVRTAAQAKKIVSLGVEKVAISAAALENMSLITQMAEEIGRQSVVVVLDVKKRLLGRtF-DV 142
gi 489204348  64 ELIAEVAGECFMPICYGGGIKTLEHAEKIFSLGVEKVSINTAALMDLSLIRRIADKFGSQSVVGSIDCRKGFWGG-H-SV 141
gi 499248946  65 EIVKTTAENVFIPITVGGGIRSVDDAKQLLRCGADKVAINTAATKNPTLISDIARRFGSQCVVLSIEAKRTVNGR-W-EV 142
gi 499717850  66 NLIDKVSSECFMPLSVGGGVNSVEQVRRLVQSGADKVVITTAALENPGLINDASAIFGRQCIVVGLDVKRE--DGaY-RL 142
gi 499634871  65 DIIGRMSEEIFMPFTVGGGVKTAEDVNALLRAGADKVSINSEAVRRPEFVREAARTFGDQCITVSIDYKRI--GShHaSV 142
gi 499484387  63 DLLKKISSQSFMPLGYAGGIKCLNDAKKIFSIGFEKISLNTIVLKNPDLITEISKIYGSQSVLVTIDVKKNFFGK-Y-YV 140
gi 488878349  63 ESIEDLAKECFMPLTMGGGIKTLEDIQKILNLGADKISINSKALEDMDFISKAANRFGSQCIVCSIDVKRK--GGqF-CV 139
gi 499937427  64 EIVEQVCSNVFIPVTVGGGIRKIKDVETLLSRGADKVSVNTGALLKPELINEISDRYGSQATVLTVECLKCGEKS-W-EA 141
gi 499442015  72 DTLSNMSESLATPLSVGGGITSFEQVQQLLDRGADKVVLNSGAVNNPQLIDLVANSYGSQCVVISIDIRKESDLSrH--V 149
gi 499439846  67 TLLYNLSENIFVPITAGGGIRSFEDAKVLFENGADKVCLNTSLIQCPHVSEKISSVYGQQSLVASIDFKHD--HGdF-KF 143
gi 499734847  63 EVIRHLAEECFMPLAFGGGISSVDEAAALFKDGIEKVSINTAFVEGGALVEEAARQFGSQSVVASIDARREADGS-Y-QV 140
gi 500033323  66 ECVEQLASECFMPLLYGGGVRNLQQIQRLFHSGVEKVMLNTAFFSGSGLLQEAVKIYGSQSLGVSIDVKKDLWGR-Y-RV 143
gi 499462147  67 DLVSWAAKECFVPLTVGGGIKTLEHIRNLLKAGADKVTINTKAIDDPDFIKNAASVFGSQCITVSVDAIKQ--GNvY-KL 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499477524 143 WTHNGTKNTKREFIEVAKEAEQLGAGEIVVNSIDDDGKMSGYDVALIKKLRESVKIPVTVLGGAGSLDDISKVIEECGTV 222
gi 489204348 142 FSENGTRDMKRSPLEWAQALEEAGVGEIFLNSIDRDGVQKGFDNALVENIASNVHVPVIACGGAGSIADLIDLFERTCVS 221
gi 499248946 143 MTDNGREHTGMDVVDWARNGEEFGAGEILLTSIDQEGTRKGFDLELVKQVSSMVSIPVIASGGMGKLEDLTEVVCESKAD 222
gi 499717850 143 YSHCGRHKTERELEEFIRDMTQRGAGEFIVNAVDRDGMMQGYDLEMIKCAKAVTDRPVLAAGGAGTFAHLTAAFQEANAD 222
gi 499634871 143 YIDGGREHVALDPVEWALRCEDLHCGEILMSSIDRDGTMQGYDLEMINTLTKRLGVPMIVSGGCGSLQHAID-ALEAGAS 221
gi 499484387 141 YNHLKKKITKYNPVDFARKMEVLGAGELVINCVDNDGVMKGYNLKLIGEISKAVKIPIVALGGAGSLKDLDD-AINVGAS 219
gi 488878349 140 YDRGNL--LEKSPLELALEYEKKGAGELLLTSVDFEGRAKGYDLELLKIFQNKLKIPLIINGGLSNPSDGVE-ALNLGAD 216
gi 499937427 142 LTDNGRNRSGREVIEWVKEAENRGAGEIVLTSIDQDGRGYGFDIDLVDIVSQAVNIPIIASGGFGKPSHIVELIKSTDVS 221
gi 499442015 150 YIDGGSTATDWSLFSWANDCASRGAGELLITSIDNDGTGTGLDLDSIRQLRYEVNLPLIASGGCGLAQHFVAGY-EVGAS 228
gi 499439846 144 FIDNGLIEVQYNIQELISFLDPLPFCEILLQSVDRDGTGTGFDLTLANTFRDQLSKPIILLGGAGHSDHLVEGLLHQSTD 223
gi 499734847 141 YSRGGTRALGIDPVEMARRAEAQGAGEILIQSIDRDGMRKGYDRNLVRSIVDATTLPVVALGGADTVDDLAQVILRDgas 220
gi 500033323 144 MSQGGQRKTGLDPVVAAQQAEQAGAGELLLNAMDQDGMQQGYDLELVQRVSRGVAIPVIAVGGAASVADFRTVVTQAGAA 223
gi 499462147 144 YDYRDGRVLDVDVVDWVRKVESYGAGEILLNSVDRDGSREGYDVELLKTVSGIVSIPVIALGGIGRFDQLAEGAIEGGCQ 223
                        250
                 ....*....|
gi 499477524 223 GVAAGSLFVF 232
gi 489204348 222 AVAAGSLFVF 231
gi 499248946 223 AVAMADVLHY 232
gi 499717850 223 AVVCASIFHF 232
gi 499634871 222 AVAISSMFLF 231
gi 499484387 220 AAGAGSLFIY 229
gi 488878349 217 ALAGAYIFHF 226
gi 499937427 222 GAAIAQALHW 231
gi 499442015 229 AVAAGTFFSQ 238
gi 499439846 224 AVATAHLLNF 233
gi 499734847 221 aaaagsmfaf 230
gi 500033323 224 AVAAGSMFVF 233
gi 499462147 224 ALSAANIFQH 233
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap