Conserved Protein Domain Family
EF_0830

?
TIGR03577: EF_0830 
conserved hypothetical protein EF_0830/AHA_3911
Members of this family of small (about 120 amino acid), relatively rare proteins are found in both Gram-positive (e.g. Enterococcus faecalis) and Gram-negative (e.g. Aeromonas hydrophila) bacteria, as part of a cluster of conserved proteins. The function is unknown. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 132616
View PSSM: TIGR03577
Aligned: 5 rows
Threshold Bit Score: 183.101
Threshold Setting Gi: 56963176
Created: 9-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 514898478   2 ITVVIADRLGKGQNVAKGVEQAGGRAVVVPGMGADMRLGDVMQQEKADLGISFCGSGGAGALTAATKYGYPERHGMRSIE 81
gi 491563890   4 VKVVIGDRLGKGQKVGMGVEAAGGSVTVIPGMAADMKLGDIMKQEEADFGISFCGSGGAGAITAQNKYGYKAKYGMRSVE 83
gi 555267171   4 ITVVIGDRLGKGQKVAAGVEKAGGRAVVVPGVAADMKLGDVMKAENATFGISFCGSGGAGAITAQNKHGYKAKYGMRSVD 83
gi 515978794   4 IKLVIGDRLGKGQKVGAGAETAGASVTIIPGMAADMKLGDVMNKEQADLGISFCGSGGAGAITAQTKYGYKCRYGMRSIE 83
gi 499565472  10 VVVVIGDRLGKGHHVAKGVEAAGGKAIVISGVGADMRLGDVMDTENADIGISFCGSGGAGAITAQTKYGYPAHYGMRSVD 89
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 514898478  82 EGVTAINDGKTVLGFGFMDQEELGKRVTEAFIKKH 116
gi 491563890  84 EGVTAINEGYNVLGFGFMDQEELGKKLVEAFVKKY 118
gi 555267171  84 EGVTAINEGCNVLGFGFMDKEELGERLVQAWQKKY 118
gi 515978794  84 EGVTAINEGCVVLGFGFMDKEELGQKLIEAFAKKH 118
gi 499565472  90 EGITAINEGKKVLGFGFMDTEELGKRITEAYLKKV 124
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap