Conserved Protein Domain Family
Pse_Me-ase

?
TIGR03587: Pse_Me-ase 
pseudaminic acid biosynthesis-associated methylase
Members of this small clade are methyltransferases of the pfam08241 family and are observed within operons for the biosynthesis of pseudaminic acid, a component of exopolysaccharide and flagellin glycosyl modifications. Notable among these genomes is Pseudomonas fluorescens PfO-1. Possibly one of the two hydroxyl groups of pseudaminic acid, at positions 4 and 8 is converted to a methoxy group by this enzyme
Statistics
?
PSSM-Id: 132626
View PSSM: TIGR03587
Aligned: 4 rows
Threshold Bit Score: 334.462
Threshold Setting Gi: 110639145
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499769299   4 YKTDQEKFWAGEFGTEYISRNANRDSI----------SKNLAFFAAALKHTRNINSCIEFGANIGINLKALKILLPKLNQ 73
gi 499633238   3 QITEQEQFWAGEFGDNYIDRNKSQELV----------AAKIAMFSRVVQRCSQIRSARELGANIGLNILALKSLLPHAAF 72
gi 499652300   3 DLSEQEQFWQGEFGNQYVDRNVGQPLV----------AANLALFAKALTRAGRIDSLLELGTNAGNNLQALRQLLPRCEL 72
gi 499905388   1 MKTKQEQFWGGEFGKEYTDRNSRESAEwdkfyienwgISKVEMNDRFLNALPKDASILEVGCNTGMQLAGLQRS-GFKHI 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499769299  74 YAIEINTDAITELNKfLPEQNIFPQSILE-YSPTKTFDLVLIKGVLIHINPEYLEKVYNLLYESSNRYLLICEYYNPSPI 152
gi 499633238  73 QAIEINSRAFERLAT-IPGIAASNTTLFE-PVEWPGVDLAFTVGVLIHLNPDMLPVAYERLYQASNRYVLTAEYYNPSVV 150
gi 499652300  73 FGVEINASACAQARA-LEIANIWHGSLFD-FPRERQYDLTLSKGVLIHLAPELLATAYAQLYALSSRYILIAEYYNPSPV 150
gi 499905388  80 YGVELQEYAVEKAKAyTKNINVIQGSGFDiPFKDNFFDVVCTNGVLIHISPDNLPTMMREMVRCSKKYIWGWEYYAEETT 159
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 499769299 153 EVTYRGHQKRLFKRDFCGEMLDLYEDLILTDYG-FVYHRDWNFPQDDINWFLLEKK 207
gi 499633238 151 EISYRGHSGRLWKRDFAGEMMDRFPDLKLVDYG-FIYHRDPVFPADDITWFLMEKR 205
gi 499652300 151 EVSYRGNSGKLFKRDFAGEMLDRYPDLQLLDYG-FGYHRDPQFPVDDITWFLLEKR 205
gi 499905388 160 TINYRGNTDYLWKADYADLFMKYCPNLKLVKKElFPYVSQAESGNKDC-MYLLEKI 214
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap