Conserved Protein Domain Family
RutF

?
TIGR03615: RutF 
pyrimidine utilization flavin reductase protein F
This protein is observed in operons extremely similar to that characterized in E. coli K-12 responsible for the import and catabolism of pyrimidines, primarily uracil. This protein is a member of the flavin reductase family defined by pfam01613. Presumably, this protein recycles the flavin of the RutA luciferase-like oxidoreductase.
Statistics
?
PSSM-Id: 132654
View PSSM: TIGR03615
Aligned: 6 rows
Threshold Bit Score: 263.582
Threshold Setting Gi: 17936376
Created: 9-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17936376   19 QRSLDYRNAMARLGAAVNIVTTDGAAGRAGFAATAVCSVSDNPPTLLVCLNRNASAYKVVKANGVICINTLAAHHEVLST 98
gi 156192821  11 VDAAAFREAMSRLASAVHLITTDGPGGRAGFTASAVCSVSDAPPTLLVCINRASSAYAALTQNGTLCVNTLGEGHETVAS 90
gi 124529136   4 VDQQTFRDAMSCMGAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSAGQEPLSN 83
gi 500263740  16 VIREDYRDAMARLAAAVNIITTDGPSGRAGFTATAVCSVTDEPPTLLVCLNRSASAHPIVTANGQLCVNTLAGAQRDLSN 95
gi 639463878  16 VSQLAFRDAMSGLAAAVNLITTDGPGGRAGFTATAVCSVTDQPPTLLVCINRSASVYDAFIENGTLCVNTLGNGQQDLSN 95
gi 491069313  29 VDQQAFRQGMSNLGAAVNVITTDGVAGKSGFTASAVCSVTDTPPTLLVCLNRSASVFETFKQNQVLCVNTLAAHQAHLSN 108
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 17936376   99 LFGGKTPAEERFAAGSWGVLETGAPVLEDALVSFDCRIREAHDGGTHDILICTVVDMKINAGDEALMYFNRRYRVL 174
gi 156192821  91 LFGGRTPVDERFAAGTWRRLRSGAPALADALVSFDCRIVGRHAVGSHDVLYCAVEAVAASGQADALLYSERRYRTL 166
gi 124529136  84 LFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCAIEAIHRHATPYGLVWFDRSYHAL 159
gi 500263740  96 LFGGKTPMAERFAAAQWSTGVTGSPLLDGATVSFDCRISHSASVGTHDILYCEVLAVYRRDSSDALVYFGRNYHGL 171
gi 639463878  96 LFGGKSSQQERFAGGQWEAGVTGAPVLDSAKLALDCKVSQSVSVGTHDILFCEVVDIRHQSGADALVYFGRRYHHL 171
gi 491069313 109 IFGGKTPMVDRFAHGEWRTLATQAPVLTDALVSFDCEVVQSLSVGSHDVFFCQVKAIQHCQGQNALMYFNRNYCEP 184
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap