Conserved Protein Domain Family
F420_MSMEG_2256

?
TIGR03617: F420_MSMEG_2256 
probable F420-dependent oxidoreductase, MSMEG_2256 family
Coenzyme F420 has a limited phylogenetic distribution, including methanogenic archaea, Mycobacterium tuberculosis and related species, Colwellia psychrerythraea 34H, Rhodopseudomonas palustris HaA2, and others. Partial phylogenetic profiling identifies protein subfamilies, within the larger family called luciferase-like monooxygenanases (pfam00296), that appear only in F420-positive genomes and are likely to be F420-dependent. This model describes one such subfamily, exemplified by MSMEG_2256 from Mycobacterium smegmatis. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 132656
View PSSM: TIGR03617
Aligned: 10 rows
Threshold Bit Score: 477.264
Threshold Setting Gi: 118465453
Created: 9-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499883192  21 ARAAEELGFSGLVTSETKHDAFLPLAVAGSVTRRLQLLTSVAIAFSRSPMEMAQTAWDLQELSEGRLILGLGTQVRAHIT 100
gi 500047541  26 ARDLETAGCDGCWTGEINHDPFLPLALAAEHTRRIQIGTSIAVAFARNPMTVAHLGWDLQAYSGGRFILGLGTQIRPHIE 105
gi 380721184  22 avaLERNGFDGGWTAEASHDPFLPLLLAAEHTSRLELGTNIAVAFARNPMIVANVGWDLQTYSKGRLILGLGTQIRPHIE 101
gi 499923562  20 SRELESLGYDALYVPETAHDPFLPVVLAAQATERVMIRTGVAVAFPRSPMHLAMVANDLHTISRGRFVLGLGSQVKPHIE 99
gi 499923257  18 ARTLEDAGYGGLWIGETQHDPFLSSLQAINATRTATVGTSIAIAFARTPMTLANIGFDLAQASEGRFVLGLGSQVKAHIE 97
gi 656073187  26 AARAQDIGFDGIWSTDVDRDPFLPLAVAAMTTTNVQLGTGIAVAFARNPMTTAMAANDLQEMSDGRFVLGLGTQIQAHIE 105
gi 501213321  26 akaaeaLGFAALWAPETAHNPFLALTIAAEHTQQLTIGTAVAIAFPRSPMVTAQIAWDLAGFSGGRFVLGLGTQVKAHIE 105
gi 499924367  17 ARAAQEAGYDGVWASEVNQDPFLPLTLAADATSTIELGTSIAVALSRSPMSLAYTAHDLARFSGGRFVLGLGSQVKAHIT 96
gi 504690177  24 THALVEAGATGVFTFEGPHDVFAPLTLASTVGG-VDLMTNVAIAFPRNPIHLAHQAIDHQLLSGGRFTLGLGTQIRTQIE 102
gi 500045489  18 aaeiaaTGADGLFTFEGQHDVFFPLLIAAEATG-CELMTNVAIAPPRSPMHLAYAAYDLQLYSGGRFRLGLGSQIKVHVE 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499883192 101 RRFGMPWGRPVARFREYILALRAIWDAFQNGTPLNFEGEFYRHTLLTPFFNPGPIDHPEIPVYIAGVGERLARLAGELCD 180
gi 500047541 106 KRFSMPWSHPVRRMREYIAALQAIWTCWRDGTSLRFEGEFYTHKIMTPMFTPEPSPAPFPKVFVAAVGERMTEMCGEAAD 185
gi 380721184 102 KRFSMPWGHPARRMREFVAALRAIWLAWQDGTKLCFEGEFYTHKIMTPMFTPEPQPYPVPRVFIAAVGEAMTEMCGEVAD 181
gi 499923562 100 KRFSAVWSEPAKRMREIVLAIQAIWRCWNDGERLDFQGEFYQHTLMTPFFNPGPNPYGTPRIQLAALGPRMTEVAGEVSD 179
gi 499923257  98 RRFSMPWSRPAARMRELVLAMRAIWACWQDGTRLDFRGDFYTHTLMTPFFSPPAHAYGPPPVYLAGVNELMTEVAGEVAD 177
gi 656073187 106 RRFSMPWSAPAERMSEYVNAIRAIWRSWRTGERLDFRGDHYQHTLMTPMFTPTPHPHGDPKIVISAVGPRMTRVAARDAD 185
gi 501213321 106 RRFSSVWDSPVGRLRDYIGALRAIWHCWQTGGKLDYRGQYYQHTLMTPFFSPGPIAHPDIPIYIAGVNTGLAHLAGEVCD 185
gi 499924367  97 RRFSMPWGRPGPQMREFILAMRAAWSSWADGTPLSFEGEYYRHTLMPPTFVPAPHPYGPPRVLLAGVGDVMTRVAGEVAD 176
gi 504690177 103 KRFGADFERPVGRMRELIGALRAIFDAWQTGERLDFRGEFYRHTLMTPTFSPGPSPYGPPPIYVGALGPQLTRATAELAD 182
gi 500045489  97 KRYGSKWEPPAARMAEAISAIKAIFAAWEGRARLDFRGEFYTHTIMAPTFDPGPNPYGPPPVLLGALGPMMTRTAAEVAD 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499883192 181 GFHVHPFHSPEYVRRVVRPGIAAGAAEAGR-------SPEEVRLATSVFVITGESREELEAQREAMRAQAAFYASTPTYR 253
gi 500047541 186 GLLAHAFTTRRYLDEVTLPALQRGMDRTGR-------SRNDFEVSCPVFLVTGSDEHQMAEAAVATRKQLAFYGSTPAYR 258
gi 380721184 182 GHLGHPMVSKRYLTEVSVPALLRGLARSGR-------DRSAFEVSCEVMVATGADDAELAAACTATRKQIAFYGSTPAYR 254
gi 499923562 180 GILLHGLSSERFVREVTLPALERGLARAGR-------KRSDVELTFPTLIATGDTDEELAESEKKLRQHFAFYASTPAYS 252
gi 499923257 178 GFFLHPFTTSRYIEEVTLPALRRGRAKAGRvgpdgegTLDGFTLAGPTFVTVGRDEVELAAAAAGTRGQIAFYASTPAYR 257
gi 656073187 186 GLLVHGFTTQRYLSEVTLPIVEEELRKVGR-------RRADFTISYPGLIASGSTDEELTRAVSAVRRQIAFYGSTPAYR 258
gi 501213321 186 GFHAHPLTSARYLREVLRPQIAAGATAAGR-------DPSACAIAGSALVITGNDKTERERMRAMVRQQIAFYASTPTYR 258
gi 499924367 177 GFLCHGFTTARWIREHTLPALAEGRRRAGG-------DLTGFDVVAGAFLATG-TEQEIVEGLATIRGQISFYGSTPAYR 248
gi 504690177 183 GLLVMPFGSKRFLHEVTVPAVRAGLNAAGR-------SADDFAVVPEIIVSVGEDDRD----HDATRRLLAFYGSTPAYR 251
gi 500045489 177 GLLVMPFNSARHFAERTLPAIGEGLRRSGR-------TLTEFPIIAQAMVAVGRDEADLATAIDGVASLIAFYGSTPAYL 249
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499883192 254 TVLEVHGWQGVGERLSELARRKRWEEMPGLISDEMLSAFAVEAPPEELGEALRERYGGLMERISLYVQ-FVPGerERFWR 332
gi 500047541 259 KVLELHGWGDLHTELHRLSLAGEWDTMGTLIDDDVLDAFAVVAPLDELADALRRRCEGAIDRVLPGFP-AAVP--PATVN 335
gi 380721184 255 KVLEQHGWGDLHPELHRLSKLGEWEAMGGLIDDEMLGAFAVVGPVDTIAGALRNRCEGVVDRVLPIF--MAAS--QECIN 330
gi 499923562 253 AVLELHGWGGLQRDLYELTRDGRWQDLGSLVTEEVLEVFTARGTPEDIPKQIRARVGDIADRVSFYSP-APIT--PEVIS 329
gi 499923257 258 GVLDLHGWGDLQPELTRLTRQGRWAELGDLIDDDMLRAFSVVGTPEEVGEQLRAKLTGVYDRATFYTA-YKVA--SEIWP 334
gi 656073187 259 HVLELHGWHDLHTELHRLSKAGDWTTMTGLIDDEVLNTFAAVGEPTEAGAEVVTRFAGLVDRFTLLTP-YPLG--DEaaa 335
gi 501213321 259 AVLSCHGWDAVGEELSRLAAQQRWAEMTGLIDDTMVATFAVEADPADLPAALKERYEGLLDRVALYIP-FIPGerDDFWR 337
gi 499924367 249 PVLDLHGWGELGAELTVLSKQNRWAEMATLIDDDVVEAFAVVAPPAEVPARIAERFAGLATRLSFTPP-PSLG--ADEVR 325
gi 504690177 252 PVLEAHGWGDLQPELNAMSKQGRWQEMSALIDDDVLHTIAACGSPAEIAAHIADRVAGVGDRVCLYQP-TPIS--LDSLA 328
gi 500045489 250 PVLQVEGWDGIQPELNALSKQGRFAQMRGLITDELVARIGIVGTPEQCAEQIAARFGEHADEVCCYFPgYTPR--PADVA 327

                 ....*...
gi 499883192 333 RLVEALLG 340
gi 500047541 336 AVLDEFRD 343
gi 380721184 331 AALQDFRR 338
gi 499923562 330 RILAGLKG 337
gi 499923257 335 ALLDASRP 342
gi 656073187 336 aivagara 343
gi 501213321 338 HLTTSLNG 345
gi 499924367 326 ELVGALRA 333
gi 504690177 329 QIVDGLRT 336
gi 500045489 328 DLIGALHR 335
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap