Conserved Protein Domain Family
urea_t_UrtB_arc

?
TIGR03622: urea_t_UrtB_arc 
urea ABC transporter, permease protein UrtB
Members of this protein family are ABC transporter permease subunits restricted to the Archaea. Several lines of evidence suggest this protein is functionally analogous, as well as homologous, to the UrtB subunit of the Corynebacterium glutamicum urea transporter. All members of the operon show sequence similarity to urea transport subunits, the gene is located near the urease structural subunits in two of three species, and partial phylogenetic profiling identifies this permease subunit as closely matching the profile of urea utilization.
Statistics
?
PSSM-Id: 132661
View PSSM: TIGR03622
Aligned: 3 rows
Threshold Bit Score: 391.919
Threshold Setting Gi: 76801646
Created: 9-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 491105845   5 INLALQFLDSFAFIVLAAAGLAIIFGIMGVINLAHGEFILIGAYTATLAVTQLGLPLVVAMLVGGVVTGLFGILTERVII 84
gi 499892054  20 VSQLLQMADSIAFIALAAIGLTVIFGMMGVINLAHGEFIMMGAYITTLSINVVSLPLPVAMILGALGTAAFGAIVERTII 99
gi 499641987  10 AALLFQFLDSFAFLVLATVGLAVIFGMMGVINLAHGEFILVGIYGTALTYH-AGLPLPVAMVSGVVMTVIFGIIVERLVV 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 491105845  85 sgawpnwvsqrtlgrdiiEPLYNRLADSMVATFGLSLILTQGARIRFGNSIDQIATPFGAISygAFSYSTYR-IVLAGVS 163
gi 499892054 100 ------------------KRLYGRLLDSMIVTFGLGLILTQGTRIIFGNSLRSIGTPFGQVP--GYTYSGYR-VLLLLAA 158
gi 499641987  89 ------------------QHLYDRLLDSMVATWGLALVVAQLLLITFGSSLDSISTPMGNVAygPYTSGTYRsVFLPLVA 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 491105845 164 IGLLLATYYLFTRTDFGMRARATIQDKETAQAMGVNTDRMYMLTFGIGSALAGLTGALFAP-VISMQPTLGDQFLVEAFV 242
gi 499892054 159 IGVLGSVYLAFTRTEFGVRARATIQDPETARAMGVDTDRMYTITFAIGSGLAGLTGALYAP-SATIVPGMGQSFLVESFV 237
gi 499641987 151 LAVLVGLYVLFTRTEFGVKARATIEDPETARAMGIDTDRMYVTTFALGSGLAGLTGALYAPaIGAITPDRGSIFLVEAFV 230
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 491105845 243 AVVVGGPSVVLGTALSGGVLGAILATFSNLYGTFIGRIALLVAALIALRFLPDGITGFIEQLR 305
gi 499892054 238 TVVTGGSSVLLGTALAGGILGTINAVFSNLYGNFFGQIALLMTAIIIIRLLPGGLTGLANTVR 300
gi 499641987 231 AVVVGGPSVVIGTLSASGLLGFVNAVFSFQLGTFVGLMAMLIVAIIALRVLPDGISGYIEQWR 293
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap