Conserved Protein Domain Family
uS9_arch

?
TIGR03627: uS9_arch 
ribosomal protein uS9, archaeal form
This model describes exclusively the archaeal ribosomal protein S9P. Homologous eukaryotic and bacterial ribosomal proteins are excluded from this model. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 132666
View PSSM: TIGR03627
Aligned: 12 rows
Threshold Bit Score: 185.624
Threshold Setting Gi: 15897035
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499466789   3 HLVVSAKRKTSIARAYFREGNGIIRINGFLLEVWQNPLARARVKEPLIIAEniipG-ITKEIDINVNVFGGGWHSQTEAV 81
gi 499819642   5 VVNTSGKNKTAIARATVSVGTGKARINKKPVDIYEPEFAKLKIIEPLMLAK----E-AVSGLDIDVKVSGGGIMGQANAI 79
gi 499642402   2 VTNTSGKKKTAVARATVSDGSGRVRINAEPVELVEPEQARLKMLEPFRIAA----DdLRDEVDIEVTVSGGGFAGQADAV 77
gi 499178140 153 VIHTSGKRKTAIARGTIREGKGRVRINKVPVELYTPELARLKIMEPLKLAG----D-VINDVDINVRVVGGGIVGQAEAA 227
gi 497674693   7 LVISSARRKTARATCYIYAGKGRVFVNNVPIELIPIEMVRLKIMEPLLLAGn---D-IRSKIDAKIITYGGGIMGQADAA 82
gi 499316923  17 VVISVGKKKTAVARAIIKPGIGRVRINGYPLELWPIEMARIKMSEPLILAG----E-LAKKVDIDVNVSGGGYMGQAVAV 91
gi 499172103   4 IVITVGKRKRAIARAVAREGKGRIRINKIPIELIEPKYKRMKLMEPILLAGe---E-VISQMDIDVTVKGGGVMGQMDAA 79
gi 499769107   3 IINTSGKRKTAVARATFRPGKGVVRINSLLLDVFSTELARMKISEPLQLLP----G-VLEGVDVSIKVAGGGIMGQAEAA 77
gi 499329353   4 VVQTTGKRKTAIARAVIREGEGRVRVNKRPVNIIEPEMARMKIMEPLIIAGe---D-IVSQVDIDVKVQGGGWMSQAEAA 79
gi 499181085   6 IVVTSGKRKTATARAVIKPGKGRVRINSVPVEIHQPELARMKIMEPLIIAK----E-LAEKVDIEVKTWGGGFMAQAEAA 80
gi 499490485   4 YIIKVGKRKTAIARAIIRKGSGKFLINGYPIELYPIEILREKMLEPIRILG----D-RSKEIDIDVNVHGGGNTGQADAT 78
gi 499219854   3 YVITTGKRKTAVARAVVKKGKGIITINGTPAELYPVEVLRNKILEPVKLAE----D-KAKGIDVTVKVKGGGVTGQADAS 77
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 499466789  82 RQAIARGLVVWTGSDQLKKAFLEYDNWLLVNDPRRKEQNKSLR--SKPRAWRQTSYR 136
gi 499819642  80 RTAIARGIVEWTNDTDLRDAFMAYDRNLLVNDSRQTETKKFGG--PGARAKYQKSYR 134
gi 499642402  78 RTAIARGLVEHTNDAELRDAFMSFDRSLLVNDVRQSEPKKWGG--PGARARYQKSYR 132
gi 499178140 228 RMVIARGLVDWTSDMDLKEKFVQYDRTMLVGDPRRSEPKKYGG--RGARARRQKSYR 282
gi 497674693  83 RMALARALVKFTGSKELEKIYRAYDRTMLAGDPRQTESEKWMR--YSARRWRQKSYR 137
gi 499316923  92 RIAMARGLVAFFQSQELKELYERYDPYMLKGDPRRTEHKKPGI--KHARSKRQKAYR 146
gi 499172103  80 RTAIGKAIVEFTGSKELRDKFLAYDRTLLVSDARRTEPHKPSRstKGPRAKRQKSYR 136
gi 499769107  78 RTALARGIVKWHNDPRMKDVYHVYDRSLLVNDSRQKEAKKPHG--RGARKKFQKSYR 132
gi 499329353  80 RIAIARGLVEWTGDPDLRDAYMAYDRHMLKGDPRRKEPKKFGG--RGARARRQKSYR 134
gi 499181085  81 RTAIARALLEFSGDEELRKAFLEYDRTLLVNDVRRKLPKIQGG--RGARARRQTSYR 135
gi 499490485  79 RTAMAKAIIEYFKDSDLEAEIRAYDRSMLVNDVRRKMPKKPMG--YGARAKRQKSYR 133
gi 499219854  78 RTAIARGIVKFLQDNELENLFRQYDRTLIVNDVRIKLPKKPGG--RGARAKKQKSYR 132
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap