Conserved Protein Domain Family
glyox_marine

?
TIGR03645: glyox_marine 
lactoylglutathione lyase family protein
Members of this protein family share homology with lactoylglutathione lyase (glyoxalase I) and are found mainly in marine members of the gammaproteobacteria, including CPS_0532 from Colwellia psychrerythraea 34H. This family excludes a well-separated, more narrowly distributed paralogous family, exemplified by CPS_3492 from C. psychrerythraea. The function is of this protein family is unknown.
Statistics
?
PSSM-Id: 132684
View PSSM: TIGR03645
Aligned: 11 rows
Threshold Bit Score: 315.956
Threshold Setting Gi: 83649348
Created: 9-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499352442   5 YPRTFSHIGISVPSVEKAVKFYTEVLGWYLIMEPTEIEED-DSPIGEMCTDVFGANWGKFKIAHMSTGDRIGVELFEFKN 83
gi 499383696   4 YPRTFSHIGISVPDLDAAVKFYTEVLGWYLIMQPTEIIED-NSAIGEMCTDVFGPNWGSFKIAHLSTGDRIGVELFQFAN 82
gi 499816062   5 YPRSFSHIGISVPDLEAAVKFYTEVLGWYLIMQPTEIVED-ESPIGEMCTDVFGVGWGSFRIAHLSTGDRIGVELFQFTN 83
gi 499788615  28 YPRSFSHIGISVPNLEQAVQFYTEVMGWYLIMQPIDITED-TSAIGEMCTDVFGEGWGSFKIAHLSTGDRIGVELFQFPN 106
gi 499832627   5 YPRSFSHIGLSVPDLDAAVKFYTEVMGWYIIMEPTEITED-DSAIGEMCTEVFGAGWGSFRIAHLSTGDRIGVEIFEFKN 83
gi 499894696   5 YPRTFSHIGISVPDVEKAVAFCTQVLGWYLIMKPTVIVED-DSPIGEMCTDVFGANWKKFKIAHLSTGDRIGVEIFEFAN 83
gi 499908968   5 YPRNFSHIGLSVTDLDAAVRFYTQVLGWYLIMPPTAITED-NSAIGLMCTDVFGKGWTSLRIAHLSTGDRIGVEIFEFNH 83
gi 499648938   5 YPRSFSHIGISVPNVEKAVEFYTQVMGWYTIMEPTEILED-KSPIGEMCTEVFGEKWEKFKIAHLSTGDRIGVEIFEFKN 83
gi 499432119   3 YPRTFSHIGLSVTDLDAAVEFYTQTLGWYVIMPPTEIVSD-DSAIGVMCNDVFGEGWGRFRIAHLSTGDKIGVEIFEFKN 81
gi 499856845   4 TPRTFSHIGLSVPDLDAAVKFYSEVLGFYVLMPPSKVVED-DSAIGVMCTDVFGPGWEHLRIAHLSTGDGIGIELFEFAG 82
gi 499719675   5 YPRAFSHIGISVPDIARALDFYQKALGWYVIMDVTEVKEEkDTAIGAMCIDVFGEGWGSFKIAHLSTSDSIGVELFEFPQ 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499352442  84 QENPENNFEYWKTGVFHFCVQDPNLEELVEKIVEAGGKKRMAEPRYYYPGEKPYRMIYMEDPFGNILEIYSHSYELTYAA 163
gi 499383696  83 QVNPENNFEYWKTGVFHFCVQDPNLEELAEKIVAAGGKKRMKAPRYYYPGEKPYRMIYMEDPFGNILEIYSHSYELHYAS 162
gi 499816062  84 QENPKDNFEYWKTGIFHFCVQDPNVEELAEKIVAAGGKKRMKAPRYYYPGEKPYRMIYMEDPFGNILEIYSHSYELHYAS 163
gi 499788615 107 QTNPENNFEYWKTGIFHFCVQDPNVEELAERIVAAGGKKRMAKPRYYYPGKKPYRMIYMEDPFGNILEIYSHSYELIYSE 186
gi 499832627  84 QEDPDNNFEYWKTGIFHFCVQDPNVEELAERMVAAGGKKRMDKPRYYYPGEKPYRMIYMEDPFGNIVEIYSHSYELIYSE 163
gi 499894696  84 QQDPADNFEYWKTGVFHFCVQDPNLEELAEAIVAAGGKKRMEKPRYYYPGEKPYRMIYMEDPFGNILEIYSHSYELTYSA 163
gi 499908968  84 VEKPENNFEYWKTGVFHFCVQDPDVEGLAEKIVAAGGKQRMPV-REYFPGEKPYRMVYMEDPFGNILEIYSHSYELTYSA 162
gi 499648938  84 QENPKDNFEYWKTGIFHFCVQDPDVEGLAERIVAAGGKKRMAEPRYYYPGEKPYRMIYMEDPFGNILEIYSHSYELIYSA 163
gi 499432119  82 AEKPKDNFEYWKTGVFHFCVQDPDVEGLAKRIVANGGKQRMPV-REYFPGEKPYRMVYCEDPFGNIIEIYSHSYELTYSA 160
gi 499856845  83 NHAPDDNFAFRRHGTFHFAIQDPDLEGLLEKIIAAGGKQRMPV-REYFPGEKPYRMVYVEDPFGNIFELYSHSYELTYSA 161
gi 499719675  85 NKTPRHEFNPYQTGVFHFCVQDPDVEGLAQRIVELGGKQRMPI-REYFPGEKPYRMVYMEDPFGNIVEIYSHSYELHYSA 163

                 ...
gi 499352442 164 GAY 166
gi 499383696 163 GAY 165
gi 499816062 164 GAY 166
gi 499788615 187 GAY 189
gi 499832627 164 GAY 166
gi 499894696 164 GAY 166
gi 499908968 163 GAY 165
gi 499648938 164 GAY 166
gi 499432119 161 GAY 163
gi 499856845 162 GAY 164
gi 499719675 164 GAY 166
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap