Conserved Protein Domain Family
YtoQ_fam

?
TIGR03646: YtoQ_fam 
YtoQ family protein
Members of this family are uncharacterized proteins, including YtoQ from Bacillus subtilis. This family shows some sequence similarity to a family of nucleoside 2-deoxyribosyltransferases (COG3613 as iterated through CDD), but sufficiently remote that PSI-BLAST starting from YtoQ and exploring outwards does not discover the relationship.
Statistics
?
PSSM-Id: 132685
View PSSM: TIGR03646
Aligned: 9 rows
Threshold Bit Score: 228.076
Threshold Setting Gi: 99078595
Created: 9-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499906604   4 WTVYLSGEIHTDWRERIVKGCIDKELDIEFSGPVTDHEASDKVGvSILGAEEKRFWEDRLGAGINGIRTRKLIDEADLVV 83
gi 499387816  30 FNVYLSGEIHTDWREEIQRGAEAAGLDVVFTAPVTDHPASDAAG-DHLGETPSDFWRDHQSAKVNAIRTRTLIEKADLVV 108
gi 489276782   3 FIVYLAGEIHSNWREEVKEKAKSLKLPITFVGPMENHERSDNIGeEIMGKQADSIAKDDAASDLNNFRTSVLMNKADVVI 82
gi 499201856   3 LMIYLAGEIHSNWRQQIKEAAKKQDLPFVFLGPMEDHTRSDNIGeEILGKQPDPVLKDDAASSINNLRTTILLNKADVVI 82
gi 517224705   2 LNVYLAGEIHSNWREEITQLCEKEKLDIKFTFPVTDHEASDNCGvEILGAEEKNFWKDRKGANINSIRTKKSIQDCDVII 81
gi 499566833   3 LVVYLAGEIHSDWREEIKRLASEKQLPIVFKGPMENHGKSDAIGeDILGKQPNAVLRDEAASSINNFRTRIWLQRADAVI 82
gi 499379052   3 LTVYLAGQIHDNWRDEVEKIAKSKNLPLHFVSPQTTHDRSDDIGeTVIGKQPSNLHRDDAASSINNFRTQVLLSKSDIVI 82
gi 499356350   3 LSVYLSGEIHTDWREKIIQGCQESNLNIVFSSAVTHHETSDSAG-DHLGAETEQFWRDNKSAKVNAIRTKTLIERCDVAI 81
gi 499856496   3 LTVYLSGEIHTDWREQIIEGAR--DLDVQFSSPVTDHDASDDCGvAILGAEDSKFWHDHKGAKLNAIRTRKGIEDADIVV 80
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 499906604  84 VRFGPKYKQWNAAFDAGYTAALGTPMIILHDEEHDHPLKEVDAAADAVARTPEQVVEMLAYILN 147
gi 499387816 109 VRFGDKYKQWNAAFDAGYCAALGKPYVTLHDADLIHPLKEVDAEAQGWCQTTDQVVETLRYVLK 172
gi 489276782  83 ALFGEKYKQWNTAMDASYAIAKGKPLIIIRPESLHHPLKELSNKANITVETVNQAIKSLSYVFE 146
gi 499201856  83 ALFGLQYKQWNTTMDAASALALQKPLILIRPKELHHPLKELANKAQVVVETPDQALQALKYIIE 146
gi 517224705  82 VKFGEKFKQWNAAFDAGYATALNKSMIVIHNDDHQHALKEVDGSAAAVASDQKQAFRILKYILE 145
gi 499566833  83 ALFGEDYRQWNTAMDAATAIEAGKPLILIRPEKLHHALKELSNKAQVVVETPAQAIAALSYVFE 146
gi 499379052  83 ALFGESYKQWNTAMDASIALTLGKPTIIVRPESLIHPLKEISNKANVTVETVEQALEVIAYIYE 146
gi 499356350  82 IRFGDKYKQWNAAFDAGYCAALDKPYITLHSEELIHPLKEVDASAQAWATSVEKVITTLKYISS 145
gi 499856496  81 VRFGDKYKQWNAAFDAGYAAALGKSIIVLSQPDHQHALKEVHAAALAVADEPRQVVEILTYVLT 144
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap