3BMZ


Conserved Protein Domain Family
violacein_E

?
TIGR03650: violacein_E 
Click on image for an interactive view with Cn3D
violacein biosynthesis enzyme VioE
This enzyme catalyzes the third step in violacein biosynthesis from a pair of Trp residues, as in Chromobacterium violaceum, but the first step that distinguishes that pathway from staurosporine (an indolocarbazole antibiotic) biosynthesis. [Cellular processes, Toxin production and resistance]
Statistics
?
PSSM-Id: 132689
View PSSM: TIGR03650
Aligned: 3 rows
Threshold Bit Score: 361.917
Threshold Setting Gi: 34498725
Created: 9-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3BMZ_A        6 PPLLPARWSSAYVSYWSPMLPDDQLTSGYCWFDYERDICRIDGLFNPWSERDTGYRLWMSEVGNAASGRTWKQKVAYGRE 85
gi 71726072   7 PPLLPMQWSSAYVSYWTPMQADDQVTSGYCWFDYARNICRIDGLFNPWSEKEHGHLLWMSEIGDARREQSRKQKVAYARQ 86
gi 88859201  10 PPLLPAQWSSSYISYWMPMQPDDDITSGYCWFDYTKNVCRIDGIFNPWPEIKMGNRLWMSEIMYPNTDESFKSKVAYARE 89
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3BMZ_A       86 RTALGEQLCERPLDDETGPFAELFLPRDVLRRLGARHIGRRVVLGREADGWRYQRP-GKGPSTLYLDAASGTPLRMVTGD 164
gi 71726072  87 AEAAGEQLQGTALADEVTPFHELFLPQAVLLDGGARHDGRHTVLGREADAWVVERA-GKPPSVFYLEAGGNRLLRMVTGN 165
gi 88859201  90 DMKSISEFSAQVLDDEIDPCHELILTQKVLIECNAQYMGIETVLGHQAEKWLFQRPdNKGPATYYFINGTNHLVRMITGD 169
                       170       180
                ....*....|....*....|....*
3BMZ_A      165 EASRASLRDFPNVSEAEIPDAVFAA 189
gi 71726072 166 DPQHLSVRDFPNLFVSDIPDSVFTS 190
gi 88859201 170 PKICASVRDFPNFNTYKIDNEIFKP 194
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap