Conserved Protein Domain Family
Rv3369

?
TIGR03667: Rv3369 
PPOX class probable F420-dependent enzyme, Rv3369 family
A Genome Properties metabolic reconstruction for F420 biosynthesis shows that slightly over 10 percent of all prokaryotes with fully sequenced genomes, including about two thirds of the Actinomycetales, make F420. A variant of the Partial Phylogenetic Profiling algorithm, SIMBAL, shows that this protein likely binds F420 in a cleft similar to that in which the homologous enzyme pyridoxamine phosphate oxidase (PPOX) binds FMN. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 132706
View PSSM: TIGR03667
Aligned: 6 rows
Threshold Bit Score: 198.46
Threshold Setting Gi: 308232436
Created: 9-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499926947   9 TAFGAKVARRLGEDRIAWLTSTDRSGTPQPAPVWFLWDfaTDSAQLYSEPTARRLSRIQTNPRSSLHLDDDGRGGDFVVL 88
gi 501800797   2 LTYPPAVLQQLRNESIIWLATVRPDGQPQVVPVWFLWD--DGAVLIYSRPRSQKVRNIRHNPRVSLHFNSDPWAEHVTRF 79
gi 499882782   2 AVVEPWVERRLREEKILWLTTVRADGQPQPVPVWFLWG--TEGFLIYSRPNAQKLRNIRSNPRVGLNLNCDERGGSVVRA 79
gi 499520641  15 TEFGAKVAERLEREQVVWLTTVGPTGTPQPNPVWFQWR--DGEFLLFSQPDTPKIRNIRRNPRVSVHFNSTVHGGDVVVF 92
gi 499915232 424 SAITASVADRLARESIVWLTTVGRNDTPVPTPVWFSWS--GTEFLIFSQPGTAKLANIGRNPQVALNFNSSPTGGDVSVF 501
gi 490009413   3 VELTQEVSARLTSDLYGWLTTVARSGQPVPRLVWFYFD--GTDLTVYSMPQAAKVAHITAHPQVSLNLDSDGNGAGIIVV 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 499926947  89 TGVLTTDPQAPPADQNPGYLVKYSEWAKNVFGSVERFATLYSVPLRFRAERT 140
gi 501800797  80 DGRAELVSDAALANERPAYLAKYRDGISRIGMTPETFAREYSLLIRVYPEHL 131
gi 499882782  80 EGTAEIVEDAAPASEIPEYVQKYREDMRRLGYEPAGFALDYAVAVRVTPRRW 131
gi 499520641  93 TGTARIAEDRPTEQEIAAFTAKYTEGLRDIPMTAEQFYADYSVPLRIAPDRL 144
gi 499915232 502 TGKARVDADGPSPEEWETYVEKYHEDMAGLDYTPEKFRQDYSTLVRVTPDGL 553
gi 490009413  81 GGTAAVVATDVDCRDDAPYWAKYREDAAKFGLTEA--IAAYSTRLKITPTRV 130
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap