Conserved Protein Domain Family
ToxGAP

?
cd00219: ToxGAP 
Click on image for an interactive view with Cn3D
GTPase-activating protein (GAP) domain found in bacterial cytotoxins, ExoS, SptP, and YopE. Part of protein secretion system; stimulates Rac1- dependent cytoskeletal changes that promote bacterial internalization.
Statistics
?
PSSM-Id: 119405
View PSSM: cd00219
Aligned: 9 rows
Threshold Bit Score: 140.242
Threshold Setting Gi: 18655413
Created: 4-Sep-2001
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:GTP binding residues [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                  #                                     
1HE1_A        11 VLQQALPMTLKGLDKAse-lATLTPEGLAREHSRLASGDGALRSLSTALAGIRAgsQVEESRIQAGRLLERSIGGIALQQ 89
1HE9_A         4 VLQQALPXTLKGLDKAse-lATLTPEGLAREHSRLASGDGALRSLSTALAGIRAgsQVEESRIQAGRLLERSIGGIALQQ 82
1G4U_S         7 SKQPLLDIALKGLKRTlpqlEQMDGNSLRENFQEMASGNGPLRSLMTNLQNLNKipEAKQLNDYVTTLTNIQVGVARFSQ 86
1HY5_A        13 FSDSIKQLAAETLPKYxqqlNSLDAEXLQKNHDQFATGSGPLRGSITQCQGLXQf-CGGELQAEASAILNTPVCGIPFSQ 91
gi 1220463   108 MLQKALPLTLGGLGKAse-lATLTAERLAKDHTRLASGDGALRSLATALVGIRDgsRIEASRTQAARLLEQSVGGIALQQ 186
gi 15077066  102 MKQAAFGSSLGGFAKAdv-lNNITGEQLGKDHASLATGNGPLRSLCTALQAVVIgsQQPQLRELATGLLARPIAGIPLQQ 180
gi 401663    102 FSDSIKQLAAETLPKYmqqlNSLDAEMLQKNHDQFATGSGPLRGSITQCQGLMQf-CGGELQAEASAILNTPVCGIPFSQ 180
gi 116489967 104 FLQKALPYTLSALDKTse-lKSINAEQLRKDHTTLATGNGALRSLVTALSGIRDgsKIEATTHQAARLLELNLGGIALQQ 182
gi 197753149  84 VRLVARDSAFLGLQRAir-sERFELDNFKSNFPYLTVANGSLRTIVTGLKGIVEf-DDGQMKDIAKEILDTQICGVPFSQ 161
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
Feature 1          ###                                    
1HE1_A        90 WGTTGGAASQLVLDASPelRREITDQLHQVMSEVALLRQAV 130
1HE9_A        83 WGTTGGAASQLVLDASPelRREITDQLHQVXSEVALLRQAV 123
1G4U_S        87 WGTCGGEVERWVDKASTheLTQAVKKIHVIAKELKNVTAEL 127
1HY5_A        92 WGTIGGAASAYVASGVD--LTQAANEIKGLAQQXQKLLSLX 130
gi 1220463   187 WGTAGGAASQHVLSASPeqLREIAVQLHAVMDKVALLRHAV 227
gi 15077066  181 WGSVGGKVTELLTSAPPelLKEAMSQLHTAMGEVADLQRAV 221
gi 401663    181 WGTIGGAASAYVASGVD--LTQAANEIKGLAQQMQKLLSLM 219
gi 116489967 183 WGTTGRQASEWVSSATQeqLGEVAAGLNDLMHEVAQLRYAV 223
gi 197753149 162 FGTCSGSARDLVDNASYqqEKIIIKHLNELFEKVALHLVGA 202

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap