Conserved Protein Domain Family
STNV

?
cd00259: STNV 
Click on image for an interactive view with Cn3D
STNV domain; satellite tobacco necrosis virus (STNV) are small plant viruses which are completely dependent on the presence of a specific helper virus, TNV, for their replication; 60 identical subunits, this domain is one of them; form an icosahedral shell around a single RNA molecule. Half of the RNA codes for the coat protein with the other half being non-coding. The STNV domain has a "Swiss roll" Greek key topology with its two 4-stranded antiparallel beta sheets
Links
?
Statistics
?
PSSM-Id: 119404
View PSSM: cd00259
Aligned: 4 rows
Threshold Bit Score: 280.989
Threshold Setting Gi: 116797
Created: 4-Sep-2001
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Ca2+ bindingputative RNA
Conserved site includes 2 residues -Click on image for an interactive view with Cn3D
Feature 1:Ca2+ binding site [ion binding site]
Evidence:
  • Structure:2BUK: binds Ca2+
    View structure with Cn3D
  • Comment:two calcium ions are bound by this domain, the third calcium ion is bound by another domain (not shown)
  • Citation:PMID 6481804

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                              #                             #                         
2BUK_A       2 AKQQNNRRKSATMRAVKRMINTHLEHKRFALINSGNTNATAGTVQNLSNGIIQGDDINQRSGDQVRIVSHKLHVRGTAIT 81
gi 2832896   7 RTQTTRSVRSLTTRDVRNIIRGEAETKRFVLVNTLNLNSTAGTVLNLSNGIIQGDDISQRAGDKIRMTKQILRVRATAIT 86
gi 116802    3 KRQSKQSNRKSVASQVRSIVESMAEQKRFAFLTNTNTVTTAGTVINLSNNIVQGDDLVNRTGDQIKTIHQTLLTRCTGIT 82
gi 116797   17 RKGSQPASKQDVKQVVKSILGQSLEHKRANLLLPPTVVNTTGNIYCLTQFVIEGDGISQRTGRVINLEQMVLRYRRTLDT 96
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                      
2BUK_A      82 V---SQTFRFIWFRDNMNRGTTPTVLEVLNTANFMSQYNPITLQQKRFTI-LKDVTLNC-SLTGESIKDRIINLPG-QLV 155
gi 2832896  87 N---SQTFRFIWFKDNTNRGTTPSVTEVLNSASFMAQYNPVTLLQHRFTI-LKDVELDC-SLSGESIKHLVMTHGG-TSC 160
gi 116802   83 N---SQSFRFIWFRDNTNRGTTPAVTEVLDSASITSQYNPTTFQQKRFTV-FQDFMLDT-SIVGRVIVHRTAVDKKrRAI 157
gi 116797   97 TsanSGFLRYIVFLDTQNQGTLPAITDVLSSLDVSSGYEVLNAQQNRFKFlLDEVESLCaSATNLSKASTLTFNQK-VQV 175
                      170       180       190       200
               ....*....|....*....|....*....|....*....|...
Feature 1                                                 
2BUK_A     156 NYNGATAVAASNGPGAIFMLQIGDSLv--GLWDSSYEAVYTDA 196
gi 2832896 161 FYNGTTAVASANGPGAIFLLVIGDSIv--GTWDVGYEAHYLDL 201
gi 116802  158 FYNGAASVAASNGPGATFVLVIGSHAt--GQYDVTAEIVYLDM 198
gi 116797  176 HYGGAADAATSNRRNAVFFLELSDKVatgPQTRLGVQLKFTDA 218

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap