Conserved Protein Domain Family

cd00377: ICL_PEPM 
Click on image for an interactive view with Cn3D
Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage. Known members are phosphoenolpyruvate mutase (PEPM), phosphonopyruvate hydrolase (PPH), carboxyPEP mutase (CPEP mutase), oxaloacetate hydrolase (OAH), isocitrate lyase (ICL), and 2-methylisocitrate lyase (MICL). Isocitrate lyase (ICL) catalyzes the conversion of isocitrate to succinate and glyoxylate, the first committed step in the glyoxylate pathway. This carbon-conserving pathway is present in most prokaryotes, lower eukaryotes and plants, but has not been observed in vertebrates. PEP mutase (PEPM) turns phosphoenolpyruvate (PEP) into phosphonopyruvate (P-pyr), an important intermediate in the formation of organophosphonates, which function as antibiotics or play a role in pathogenesis or signaling. P-pyr can be hydrolyzed by phosphonopyruvate hydrolase (PPH) to from pyruvate and phosphate. Oxaloacetate acetylhydrolase (OAH) catalyzes the hydrolytic cleavage of oxaloacetate to form acetate and oxalate, an important pathway to produce oxalate in filamentous fungi. 2-methylisocitrate lyase (MICL) cleaves 2-methylisocitrate to pyruvate and succinate, part of the methylcitrate cycle for the alpha-oxidation of propionate.
PSSM-Id: 119340
View PSSM: cd00377
Aligned: 236 rows
Threshold Bit Score: 115.278
Threshold Setting Gi: 19111859
Created: 6-Mar-2002
Updated: 17-Jan-2013
Aligned Rows:
Conserved site includes 13 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
Feature 1                                              # ###              #                      
                         90       100       110       120       130       140       150       160
Feature 1                                       # #                              #               
1DQU_A       137 hdrkqreermttpkdqrhkvanvdylRPIIADADTGHGgl---taVMKLTKLFVE-RGAAGIHIEDQapgtkkcghmagk 212
1F8I_A       132 adqiaki---------egdtsvenwlAPIVADGEAGFGga---lnVYELQKALIA-AGVAGSHWEDQlasekksghlggk 198
gi 169177219  81 -------------------------dLPVTADLDDGYQd------PAETIRRAIG-LGIAGANVEDRlr----------- 117
gi 170940284 118 ------------------------fnLPLTVDIQDGYAgpgdhaeLRSVIEKVILeLGAVGVNLEDTwhests------g 167
2QIW_A        80 -------------------------sIPVSVDVESGYGl-----sPADLIAQILE-AGAVGINVEDVvhsegk------- 121
gi 163797332  82 -------------------------aVPVVADAEGGFHep---gnIWRTVRAFEE-AGVAAIHIEDHaggkhtdl---pq 129
gi 152966926  80 -------------------------dLPVSADLDGGFGn------AGETVRKAIG-VGVVGANVEDQlr----------- 116
gi 169631485  80 -------------------------dLPVSVDIESGYAq-----tAQRLIEGLIE-AGAVGLNIEDTvhsegg------- 121
gi 116669464  81 -------------------------sLPVSADLESGYGs------PGETIQKAIG-VGIVGANIEDQmr----------- 117
gi 62423771   82 -------------------------dVPVSADLESGYDt-----aAPDLIAGLLE-AGAVGVNIEDTvhseg-------- 122
                        170       180       190       200       210       220       230       240
Feature 1                                       #                                                
1DQU_A       213 vlvpiSEHINRLVAIRAQAdim-gtdLLAIARTDSeaatlitstidhrdhpfiigstnpdiqplndlmvmaeqagkngae 291
1F8I_A       199 vliptQQHIRTLTSARLAAdva-dvpTVVIARTDAeaatlitsdvderdqpf---------------------------- 249
gi 169177219 118 ---pfDEAVSRVAAIVRAAeae-gvpFQLNARTDAlvrggdr-------------------------------------- 155
gi 170940284 168 dmvpeDEAIERIKTVIRTArelgvvdFVVNARSDTflmg----------------------------------------- 206
2QIW_A       122 rvreaQEHADYIAAARQAAdva-gvdVVINGRTDAvklgad--------------------------------------- 161
gi 163797332 130 sliplESMIARLKAALEARrd---pnFQIIARTDAvwat----------------------------------------- 165
gi 152966926 117 ---plAESVANVEAIVAAGeae-gvpFVLNARTDAlvrggdr-------------------------------------- 154
gi 169631485 122 rlrepQEHADLVGALRVAAdqs-gvpVVINARTDVllrqig--------------------------------------- 161
gi 116669464 118 ---plADAVAQMAAAAQAGrae-gidFVLNARTDAflkgkdr-------------------------------------- 155
gi 62423771  123 rlrsaEEHAEYIGDLRRAAdaq-rvhVVINARTDVfknpdd--------------------------------------- 162
                        250       260       270       280       290       300       310       320
Feature 1                                                                                        
1DQU_A       292 lqaiedewlakaglklfndavvdainnsplpnkkaaiekyltqskgksnlearaiakeiagtdiyfdweaprtregyyry 371
1F8I_A       250 -------------------------------------------------------------------itgertregfyrt 262
gi 169177219 156 ------------------------------------------------------------------------------pi 157
gi 170940284     --------------------------------------------------------------------------------
2QIW_A       162 ------------------------------------------------------------------------------vf 163
gi 163797332     --------------------------------------------------------------------------------
gi 152966926 155 ------------------------------------------------------------------------------gr 156
gi 169631485 162 ------------------------------------------------------------------------------ee 163
gi 116669464 156 ------------------------------------------------------------------------------dp 157
gi 62423771  163 -------------------------------------------------------------------------------f 163
                        330       340       350       360       370       380       390       400
Feature 1                                 #                              # #                     
1DQU_A       372 qggtQCAINRAVAYAPF--ADLIWMESkl---pdYKQAKEFadgvhavwpeqKLAYNLSpsfnwkkamprdeqetyiKRL 446
1F8I_A       263 kngiEPCIARAKAYAPF--ADLIWMETgt---pdLEAARQFseavkaeypdqMLAYNCSpsfnwkkhlddatiakfqKEL 337
gi 169177219 158 qesiDDAIARGRAFLDAg-AALVFVPGal----tGEVIEPLvegl----grgKLSIIGApga------------lpaAQL 216
gi 170940284 207 -gslDESIRCGKRYLDEggAETVFIFWprnkemeKADVQKVide-----lggRVNVSCRlggq-----------lttGEL 269
2QIW_A       164 edpxVEAIKRIKLXEQAg-ARSVYPVGls----tAEQVERLvda-----vsvPVNITAHpvdgh--------gagdlATL 225
gi 163797332 166 -kdpEEALRRVRAFTAAg-ADMVFPTGa-----tPELIAGFrn-------evPARYVVIdgp-------------ghPRF 218
gi 152966926 157 dvwlPDAIERGRAYLAAg-ATSVFVPGpl----dEDAVQQLvaa-----fgpQKLSVIGfpgv-----------pdqARL 215
gi 169631485 164 sdrvDRAIARLKLAAEAg-ADSLYPVGrh----dPDVQRRLtse-----lplPVNAIAVpdv------------ddpASF 221
gi 116669464 158 advlADAIERGRAFLDVg-ATTVFVPGll----dEPTVAALvegi----grnKVSVINVpgs------------lapAKL 216
gi 62423771  164 edptAEVIRRLNLCAEAg-ADSVYPVRlp----nTETLKTIlsq-----vrlPLNVTAHpvkgav------pdeldlSQL 227
                        410       420       430
Feature 1                          #                 
1DQU_A       447 GAl--------gYAWQFITlagLHTTALISDTFAKA 474
1F8I_A       338 AAm--------gFKFQFITlagFHALNYSMFDLAYG 365
gi 169177219 217 QEl--------gVARVSYGpftQRVALRALRDLATD 244
gi 170940284 270 GQm--------gAARVSVGpqvFLAAAEAIKKAAGA 297
2QIW_A       226 AGl--------gVRRVTFGplwQKWLAATSAQQLKG 253
gi 163797332 219 AGretaaslvlyYGFTLFAa--TRGLTLALDRLRAE 252
gi 152966926 216 AEl--------gVARITYGpltQRVALTALQDAARG 243
gi 169631485 222 GPl--------gVGRISFGpffQRALSARAEEILGR 249
gi 116669464 217 QEl--------gVARISYGpwtQRVALTAFADATAE 244
gi 62423771  228 QDl--------gVKRVTFGpllQATMYDYFAKFTRN 255

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap