Conserved Protein Domain Family
SHMT

?
cd00378: SHMT 
Click on image for an interactive view with Cn3D
Serine-glycine hydroxymethyltransferase (SHMT). This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). SHMT carries out interconversion of serine and glycine; it catalyzes the transfer of hydroxymethyl group of N5, N10-methylene tetrahydrofolate to glycine resulting in the formation of serine and tetrahydrofolate. Both eukaryotic and prokaryotic SHMT enzymes form tight obligate homodimers; the mammalian enzyme forms a homotetramer comprising four pyridoxal phosphate-bound active sites.
Statistics
?
PSSM-Id: 99733
View PSSM: cd00378
Aligned: 34 rows
Threshold Bit Score: 393.106
Threshold Setting Gi: 26541523
Created: 6-Mar-2002
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:active site region binds glycine, pyridoxal phosphate, and folate
  • Structure:1EJI; Serine Hydroxymethyltransferase
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                  #                                                    
1BJ4_A       17 KDSDVEVYNIIKKESNRQRV-GLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYK 95
1EJI_A       21 KDSDAEVYSIIKKESNRQRV-GLELIASENFASRAVLEALGSSLNNKYSEGYPGQRYYGGTEFIDELEXLCQKRALQAYH 99
gi 6919896   33 LHAFPSIGQSIVQELKSQRS-RLKMIASENFSSLSVQLAMGNLLTDKYCEGSPFKRFYSCCENVDAIEWECAETAKELFG 111
gi 25090469   4 LEDVHSVVRAVEKHHEWLKK-CLPMIASENVTSPAVREMLVTDFGHRYAEGKPGERLYEGCEYIDEVELACVRLAKELFG 82
gi 20141442   3 YEDAEYIREMAMKHSEMFGE-GIALIASENVMSPLAKEVMISDLESRYAEGLPHHRYYQGNYYVDLIEDRTNELLSKLFR 81
gi 20138435   4 PKELEKVLEITKAQNVWRRTqTLNLIASENVMSPLAESVYMSDFMSRYAEGKPYKRYYQGTKYTDEIETLTMELMNEITN 83
gi 20138245   3 PREIEELLNIILQHNTWRRKeTINLIASENVMSPLAELVYVNDFAGRYAEGTVGNRYYQGTKYVDILEDSLSKRFAKVLD 82
gi 6685485    4 REYRDKVLHFIEEHEKWRSH-TINLIASENITSPSVNRAVASGFMHKYAEGWPKQRYYQGCKYVDEVELIGVELFTKLFK 82
gi 2500784    4 SDVPKFIRDVSIKQHEWMRE-SIKLIASENITSLAVREACATDFMHRYAEGLPGKRLYQGCKYIDEVETLCIELSKELFK 82
gi 23484165  12 EKSDKELYSILLDEEKRQKE-TINLIASENLINASVKECLGHVVSNKYSEGYPRKRYYGGNDYIDKIEELCCKRALETFN 90
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                #      
1BJ4_A       96 LdpqcwGVNVQPYSGSPANFAVYTALVEPHG-------------------------------RIMGLDLPDGGHLTHGFm 144
1EJI_A      100 LdpqcwGVNVQPYSGSPANFAVYTALVEPHG-------------------------------RIXGLDLPDGGHLTHGFx 148
gi 6919896  112 Ae----SAFVQPHSGADANLLAIMSIITQKIqspavqrlgyktindlpeqeyealkaemaqhKCLGPSLNSGGHLTHGTv 187
gi 25090469  83 Ae----HANVQPTSGVVANLAALFALTEPGD-------------------------------TILGLRISHGGHISHHDi 127
gi 20141442  82 Ts----QTDPRPISGTNANSAAIYALAGPGD-------------------------------LVATPSLSGGGHISAAEf 126
gi 20138435  84 Sk----DCDLRPTSGTIANAAVFRVLAEPGD-------------------------------KALIAPVQAGAHVSHTKf 128
gi 20138245  83 Ak----FVDVRPISGTIANLATYHALVPEGG-------------------------------IVASLPVKYGGHISHNTv 127
gi 6685485   83 Sd----YADLRPVSGTNANQAVFFGLGQPGD-------------------------------KVIVLHTSHGGHISHMPf 127
gi 2500784   83 Ae----HANVQPTSGVVANLAVFFAETKPGD-------------------------------KLMALSVPDGGHISHWKv 127
gi 23484165  91 LnseewGVNVQSLSGSAANVQALYALVGIKG-------------------------------KILGMHLCSGGHLTHGFf 139
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
1BJ4_A      145 tdkkkISATSIFFESMPYKVNpdTGYINYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISG 224
1EJI_A      149 tdkkkISATSIFFESXPYKVYpeTGYINYDQLEENASLFHPKLIIAGTSCYSRNLDYARLRKIADDNGAYLXADXAHISG 228
gi 6919896  188 ----rMNIMSKLMHCLPYEVNldTELFDYDEIAKIAKEHKPTVLIAGYSSYSRRLNFATLKQIAEDCGAVLWVDMAHFAG 263
gi 25090469 128 s---aPGVRGLNVEYLPFDEE--DMAIDVDGMVRKIEEVEPSVVMLGASLFLFPHPVEEAVEAVEAVGGYVVYDAAHVLG 202
gi 20141442 127 g---iLGMRSVRTINYPYDMD--TMTIDPDQASKMIIKEKPKVCLFGQSVFMFPAPLKEMAEAFHEVGCKVWYDGAHVLG 201
gi 20138435 129 g---tLGALGIQHIEMPFDEE--NINVDVDKAIKMIEEVKPKFVVLGGSLYLFPHPTKELAQHVHAVGAKLVYDAAHVYG 203
gi 20138245 128 g---gLKALRVKTVELPWDFE--NFNIDIDAARKIIEEKRPNLIILGASLYLFPHPVREIANAAKAVGAYVLHDSAHVFG 202
gi 6685485  128 g---aAGMRGLEVHTWPFDFE--SFNIDVDKAEKMIRELEPKIVVFGGSLFPFPHPVKELAPVAKEVGAFVVYDAAHVLG 202
gi 2500784  128 s---aAGIRGLKVINHPFDPE--EMNIDADAMVKKILEEKPKLILFGGSLFPFPHPVADAYEAAQEVGAKIAYDGAHVLG 202
gi 23484165 140 dekkkVSVTSDMFESKLYKSNs-EGYVDLDVVREMALSFKPNVIICGYSSYPRDLDYKRFREIADEVNAYLLADIAHISS 218
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                #                                                      
1BJ4_A      225 LVAAGVVPSPFE---HCHVVTTTTHKTLRGCRAGMIFYRkgvksvdpatgkeilynLESLINSAVFPGLQGGPHNHAIAG 301
1EJI_A      229 LVAAGVVPSPFE---HCHVVTTTTHKTLRGCRAGXIFYRkgvrsvdpktgketyyeLESLINSAVFPGLQGGPHNHAIAG 305
gi 6919896  264 LVAGGVFVGEENpmpYADIVTTTTHKTLRGPRGGLVLAKk----------------EYANTLNKACPLMMGGPLPHVIAA 327
gi 25090469 203 LIAGGQFQDPIRe--GAHVVTGSTHKTFPGPQGGIVLCQr---------------dLADDIDEAVFPGLVSNHHLHHVAA 265
gi 20141442 202 LIAGGRFQDPLRe--GADIVTGSTHKTFPGPQHGVILGNtd-------------deTWKAVRRAVFPGVLSNHHLNAMAA 266
gi 20138435 204 LIEGKVWSNPLKd--GADIMTVSTHKTFPGPQGGAIFSDgs--------------eVFKQVSKTIFPWFVSNHHLHRLPA 267
gi 20138245 203 LIIGGVFPNPLKe--GAHVITSSTHKTFPGPQGGLIASVtd-------------eeLNNAIQRAVFPVFTSNYHLHRYAA 267
gi 6685485  203 LIAGGEFQDPLRe--GADIMTASTHKTFPGPQGGVILYKkfa-----------ddeTIAKLQWAIFPGVVSNHHLHHMAG 269
gi 2500784  203 LIAGKQFQDPLRe--GAEYLMGSTHKTFFGPQGGVILTTk---------------eNADKIDSHVFPGVVSNHHLHHKAG 265
gi 23484165 219 FIACGNLNNPFL---YADVVTTTTHKILRGPRSAMIFFNkkr-----------npgIEQKINSSVFPSFQGGPHNNKIAA 284
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
1BJ4_A      302 VAVALKQAMTlEFKVYQHQVVANCRALSEALTELGYKIVTGGSD---NHLILVDLRsk-gTDGGRAEKV--LEACSIACN 375
1EJI_A      306 VAVALKQAXTtEFKIYQLQVLANCRALSDALTELGYKIVTGGSD---NHLILXDLRsk-gTDGGRAEKV--LEACSIACN 379
gi 6919896  328 KAIALKEAMTiNFRKYAHKVVENARTLAEVFQRNGLRLLTGGTD---NHMLIIDLTsl-gVPGRIAEDM--LTSVGIAVN 401
gi 25090469 266 LAVALAEFKE-YGERYARDTVRNAKALAEALYAEGLRVLCEHRGfteSHQIAVDVR----EQGGGAVIAekLESANILCN 340
gi 20141442 267 LGITAAEELE-FGKRYADDIISNAKVLAEELYANGFNVLAEKRGfteSHTMAVDVS----KNGGGKYVAetLEKCGIILN 341
gi 20138435 268 TAVTAIEMKY-FGESYANQILRNSKALAEALAERGFKVIGENLGytkSHQVAVDVR----QFGGGNKIAklLEDANIIVN 342
gi 20138245 268 TYVTLIEMEH-FGAEYGARIVENAKALAEALAEEGVTPVGERLGytkTHQVAVDVS----KFGGGDKVArlLEEANIIVN 342
gi 6685485  270 KVITAAEMLE-YGEAYAKQIVKNAKALAEALAEEGFKVIGEDQGytkSHQVIVDVSdlhpAGGGWAAPL--LEEAGIILN 346
gi 2500784  266 LAIALAEMLE-FGEAYAKQVIKNAKALAQALYERGFNVLCEHKDfteSHQVIIDIEsspdIEFSASELAkmYEEANIILN 344
gi 23484165 285 VACQLKEVQTeSFKNYTKQVLENSKALAKFLINNNIDLVTNGTD---NHIVLIDLRky-gITGSKLQEV--CNTINISIN 358
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                         #                                                             
1BJ4_A      376 KNTCPGdrs--alrPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELtlqiqsdtgvaatlk-efkerlagdkyqaavQ 452
1EJI_A      380 KNTCPGdks--alrPSGLRLGTPALTSRGLLEEDFQKVAHFIHRGIELtlqiqshxatkatlkefkeklagdekiqsavA 457
gi 6919896  402 RNTIPSdasg-qwkTSGIRLGTPALTTLGMGSAEMEEVANIIVKVLRNitvrsnaesgss--------ksegelsegiaQ 472
gi 25090469 341 KNLLPWddeskshdPSGIRLGTQELTRLGMGLSEMEYIAELIADVVLGrr---------------------------epS 393
gi 20141442 342 KNLLPWddnkksqnPSGIRIGVQEATRVGMGKSEMKEIASLITRAIIRhe---------------------------dpE 394
gi 20138435 343 KNLLPYdkpedvsdPSGLRIGVQEMTRYGMKEGEMEEIAELFKKVIIDkk---------------------------dvN 395
gi 20138245 343 KNALPWdks--vlkPSGIRMGVQEMTRFGMGKGEMKEIAKFIARVLKGedpta---------------------vkrevV 399
gi 6685485  347 KNLLPWdplekvnePSGLRIGVQEMTRVGMMEDEMKEIAHFMKRVLIDke---------------------------dpK 399
gi 2500784  345 KNLLPWddvnnsdnPSGIRLGTQECTRLGMKEKEMEEIAEFMKRIAIDke---------------------------kpE 397
gi 23484165 359 KNTIPSdnd--cvsPNGARLGTPAMTTRGAKENDMKFIADTLLKAIKIaaslqekygkklv------efkkgltnnpelD 430

                ....*....
Feature 1                
1BJ4_A      453 ALREEVESF 461
1EJI_A      458 TLREEVENF 466
gi 6919896  473 EARQRVADL 481
gi 25090469 394 EVRKDVEEL 402
gi 20141442 395 KIKAEVKQL 403
gi 20138435 396 EVKKEVIEM 404
gi 20138245 400 EFRKTFIEI 408
gi 6685485  400 KVRKDVYYF 408
gi 2500784  398 KVREDVKEF 406
gi 23484165 431 ALKKEVVQW 439

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap