1CMC,1CMB,1CMA


Conserved Protein Domain Family
Met_repressor_MetJ

?
cd00490: Met_repressor_MetJ 
Click on image for an interactive view with Cn3D
Met Repressor, MetJ. MetJ is a bacterial regulatory protein that uses S-adenosylmethionine (SAM) as a corepressor to regulate the production of Methionine. MetJ binds arrays of two to five adjacent copies of an eight base-pair 'metbox' sequence. MetJ forms sufficiently strong interactions with the sugar-phosphate backbone to accomodate sequence variation in natural operators. However, it is very sensitive to particular base changes in the operator. MetJ exists as a homodimer.
Statistics
?
PSSM-Id: 119402
View PSSM: cd00490
Aligned: 7 rows
Threshold Bit Score: 200.925
Threshold Setting Gi: 114771529
Created: 6-Mar-2002
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 13 residues -Click on image for an interactive view with Cn3D
Feature 1:corepressor binding sites
Evidence:
  • Structure:1CMC_A: binds S-adenosylmethionine (SAM), defined using 4.5 A contacts
    View structure with Cn3D
  • Structure:1CMA_A: binds SAM, defined using 4.5 A contacts
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                              #  ##            #  ### ### #  ##         
1CMC_A         1 AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKER 80
1CMB_B         1 AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKER 80
1CMA_A         1 AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKER 80
gi 1170935     2 ANWDGKYISPYAEHGKKSEQVKKITVSIPIKVLEILTNERTRRQLKSLRHATNSELLCEAFLHAFTGQPLPTDADLMKER 81
gi 28807776    2 ADWNGEYISPYAEHGKKSEQVKKITVSIPLKVLKVLTDERTRRQINNLRHATNSELLCEAFLHAYTGQPLPTDEDLRKDR 81
gi 24350423    2 TEWNGEYISPYAEHGKKNEQVKKITVSIPLKVLKVLTDERTRRQVNNLRHATNSELLCEAFLHAYTGQPLPDDADLSKEC 81
gi 114771529   2 AQWNGKYIHPYAEHGKKSEQVKKVTVSIPINVLKVLTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPNDNDLKKGN 81
                         90       100
                 ....*....|....*....|...
Feature 1                               
1CMC_A        81 SDEIPEAAKEIMREMGINPETWE 103
1CMB_B        81 SDEIPEAAKEIMREMGINPETWE 103
1CMA_A        81 SDEIPEAAKEIMREMGINPETWE 103
gi 1170935    82 NDEIPEDAKVLMRELGVDPESWE 104
gi 28807776   82 PDDIPTEAKALMTAMGIEFEAFD 104
gi 24350423   82 PDSIPAEAKRLMDEMGIEWEDME 104
gi 114771529  82 KNRIPESVRQLMEEMGLEAELEA 104

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap