Conserved Protein Domain Family
Trp-synth-beta_II

?
cd00640: Trp-synth-beta_II 
Click on image for an interactive view with Cn3D
Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions. This CD corresponds to aminocyclopropane-1-carboxylate deaminase (ACCD), tryptophan synthase beta chain (Trp-synth_B), cystathionine beta-synthase (CBS), O-acetylserine sulfhydrylase (CS), serine dehydratase (Ser-dehyd), threonine dehydratase (Thr-dehyd), diaminopropionate ammonia lyase (DAL), and threonine synthase (Thr-synth). ACCD catalyzes the conversion of 1-aminocyclopropane-1-carboxylate to alpha-ketobutyrate and ammonia. Tryptophan synthase folds into a tetramer, where the beta chain is the catalytic PLP-binding subunit and catalyzes the formation of L-tryptophan from indole and L-serine. CBS is a tetrameric hemeprotein that catalyzes condensation of serine and homocysteine to cystathionine. CS is a homodimer that catalyzes the formation of L-cysteine from O-acetyl-L-serine. Ser-dehyd catalyzes the conversion of L- or D-serine to pyruvate and ammonia. Thr-dehyd is active as a homodimer and catalyzes the conversion of L-threonine to 2-oxobutanoate and ammonia. DAL is also a homodimer and catalyzes the alpha, beta-elimination reaction of both L- and D-alpha, beta-diaminopropionate to form pyruvate and ammonia. Thr-synth catalyzes the formation of threonine and inorganic phosphate from O-phosphohomoserine.
Statistics
?
PSSM-Id: 107202
View PSSM: cd00640
Aligned: 318 rows
Threshold Bit Score: 79.0961
Threshold Setting Gi: 42527695
Created: 1-Aug-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
catalyticpyridoxal
Conserved site include 1 residue -Click on image for an interactive view with Cn3D
Feature 1:catalytic residue [active site]
Evidence:
  • Comment:pyridoxal 5'-phosphate (PLP) forms an internal aldimine bond (Schiff base linkage) with the catalytic residue lysine
  • Structure:1KL7_A; catalytic residue (lys) and cofactor (PLP)
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                      #                                                 
1BEU_B        57 TALTKcqnitagtrttLYLKREDLLHgGAHKTNQVLGQALLAKrmg-------------kseIIAETgagQHGVASALAS 123
1KL7_A        97 TPLVQnvtg---dkenLHILELFHGPtYAFKDVALQFVGNLFEyflqrtnanlpegekkqitVVGATs-gDTGSAAIYGL 172
gi 82180385   90 VPITRlk-------sgLNVMEMWHGVtHAFKDLAMSCVGELLDyflkrk--------nkhvtILVATs-gDTGSSAIESV 153
gi 158706354  90 VHLSRlr-------ngLNVLELWHGVtYAFKDLSLSCTTQFLQyflekr--------ekhvtVVVGTs-gDTGSAAIESV 153
gi 123898412  90 VRLVQlk-------dsLSILELFHGEtLAFKDLAMSCTAHFLQyflrrd--------rqratILVGTs-gDTGSSAIRSV 153
gi 15894286   91 APIKKag--------dTYFLELYHGPtLAFKDMALSILPYLLKtaskkng------iqdkivILTATs-gDTGKAALEGF 155
gi 24378595   90 APLVKln--------gQYNLELFHGStIAFKDMALSILPYLLTtsakkqg------innkivILTATs-gDTGKAAMAGF 154
gi 28211951   92 VPIVKke--------dVYFLELYHGPtLAFKDMALSILPYLLKaslkknk------iekevvILTATs-gDTGKAALEGF 156
gi 23465602   90 TPLKPlg--------dDYVLELFNGPtSAFKDVALQILPRFMAhttpadg-----dadekimILTATs-gDTGKAALAGF 155
gi 62511212  328 APVRHls-------gnQFILELFHGPtGSFKDLSLQLMPHIFAhcipp---------scnymILVATs-gDTGSAVLNGF 390
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1BEU_B       124 al------lgLKCRIYMGakdverqsPNVFRMRLMg---aEVIPVhsgsatlkdACNEALRDWsgs----------yetA 184
1KL7_A       173 rgk-----kdVSVFILYPtgr--ispIQEEQXTTVpdenvQTLSVtgt---fdnCQDIVKAIFgdkef------nskhnV 236
gi 82180385  154 rrr-----enMDIIVLLPhgr--ctkIQELQMTTViednvHVFSVdgt---sdeLDYPIKRLFadsdf------vkkhnI 217
gi 158706354 154 qga-----knMDIIVLLPkgh--ctkIQELQMTTVlkqnvHVFGVegn---sdeLDEPIKTVFadvaf------vkkhnL 217
gi 123898412 154 lgl-----reVDIVVVFPrgr--itkIQELQMTTSvaenvHVFAAdgt---sddIDVPLRKLFadadl------vqrhrL 217
gi 15894286  156 kdv-----egTEIIVFFPndg--vseVQRLQMVTQkgkntHVVAIrgn---fddAQSGVKKIFtdkefiqe-lkenncvF 224
gi 24378595  155 adv-----pgTEIIVFYPngg--vskIQELQMTTQvgdntHVVAIegn---fddAQTNVKKMFndsdlrtk-llehgaqF 223
gi 28211951  157 adv-----ddTKIIVFYPehg--vspIQKKQMSTQkgentYVIGVngn---fdeAQNSIKEIFndevlees-iekkgyiF 225
gi 23465602  156 ada-----pgTAITVFYPegk--vsqVQELQMTTQagsnvQVAAVegn---fddAQSAVKRIFgdralaerlagnshvvL 225
gi 62511212  391 srlnkndkqrIAVVAFFPeng--vsdFQKAQIIGSqrengWAVGVesd---fdfCQTAIKRIFndsdftgfltveygtiL 465
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1BEU_B       185 HYMlgtaagphpypTIVREFQRMIGEETKAQIldke----grlpDAVIACVGGGSNAIGMFADFINdt-svGLIGVEPgg 259
1KL7_A       237 GAVns-------inWARILAQXTYYFYSFFQAtngk----dskkVKFVVPSGNFGDILAGYFAKKXglpieKLAIATNen 305
gi 82180385  218 MSTns-------vnWARILVQIAHFFYGYMQCaplt----eltpVEIIVPTGGAGNITAGCIAQAMglpihLVAVVNRnd 286
gi 158706354 218 MSLns-------inWSRVLVQMAHHFFAYFQCtpsldt-hplplVEVVVPTGAAGNLAAGYIAQKIglpirLVVAVNRnd 289
gi 123898412 218 MSLns-------vnWSRIMVQTAHFLFAYLQLtpslpegdtlpvLEVLVPTGGAGNITAGIIVKRMgvplrLVAMVNAnd 290
gi 15894286  225 SSAns-------inIGRLVPQIVYYFYAYSKMcskgei-nfgekINFVVPTGNFGNILAAYFAKSMgvpinKLICASNdn 296
gi 24378595  224 SSAns-------mnVGRLVPQVVYYVYAYAQLlksgdi-kngdrVNFTVPTGNFGNILAAYYARQIgvpigKLICASNen 295
gi 28211951  226 SSAns-------inIGRLIPQIVYYVYSYMWLlkkgei-eegeeINIVVPTGNFGNILAAYYSKKMgipvnKFICASNen 297
gi 23465602  226 SSAns-------inVGRLVPQVVYYFSAYAQLladqvi-nvgdeVEFVVPTGNFGDILAGYYAKLLglpvkHLVVASDkn 297
gi 62511212  466 SSAns-------inWGRLLPQVVYHASAYLDLvsqgfi-sfgspVDVCIPTGNFGNILAAVYAKMMgipirKFICASNqn 537
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1BEU_B       260 hgietgehgaplkhgrvgiyfgmkapmmqta----------------------dgqieesysisagldfpsvgpqhayln 317
1KL7_A       306 dildrflksglyersdkvaatlspaxdilissnferllwylareylangddlkageivnnwfqelktngkfqvdksiieg 385
gi 82180385  287 ivhrtvqygdfslgdtkatlasamdiqepynmeril-----------wllagsekshikemmkefqekkrvklpeqlhkk 355
gi 158706354 290 iihrtvqqgdfslseavkstlasamdiqvpynmervf----------wllsgsdsqvtralmeqfertqsvnlpkelhsk 359
gi 123898412 291 ivhrtvqsgdfsmsssvtqtlapaidiqdpynmervf----------wllsggdglmvkslmeefqkthklslpaslhqq 360
gi 15894286  297 kvlydffengtydrnrefvttispsmdilissnlerl----------iylvcdrdsskvadfmrelseggkynitenmkk 366
gi 24378595  296 nvltdffktgtydkkrefrvttspsmdilvssnlerl----------ifhllgndsvktkelmqaliekgeytlekadka 365
gi 28211951  298 nvlceffnkgiydknkefkitsspsmdilissnlerl----------iyeicdgnedkvktymdklkyggtyeldkeele 367
gi 23465602  298 nvlfdflttgtynrqrpffqtispsmdilissnlerm---------lyylsegdtrlismlmndlnkwgtyeipeellak 368
gi 62511212  538 hvltdfiktghydlrerklaqtfspsidilkssnlerh--------lhlmankdgqlmtelfnrlesqhhfqiekalvek 609
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
Feature 1                                                                          
1BEU_B       318 sigraDYVSITdDEALEAFKTLCrh----egIIPALESSHALAHALKMmreqpekeqLLVVNLSGR 379
1KL7_A       386 askdfTSERVSnEETSETIKKIYessvnpkhYILDPHTAVGVCATERLiakdndksiQYISLSTAH 451
gi 82180385  356 iagamTSCVVTdENILGTIGRCWee----nhYLLCPHSAVAVYYHYQQmdsn--dksPRCCLAPAS 415
gi 158706354 360 lseavTSVSVSdEAITQTMGRCWde----nqYLLCPHSAVAVNYHYQQidrq-qpstPRCCLAPAS 420
gi 123898412 361 lsevlSSGSVSdDGILEAMRRCWqd----nhYLICPHTAVAVWRHYQSpvr---pgeSRCCIATAS 419
gi 15894286  367 klkdfYAGYATeEETKKAIEKMYke----nkYLIDTHTAVAYSVYEKYlknt-kdkaKTVIASTAS 427
gi 24378595  366 ildlfAAGFATeEETAAEIKRVYta----srYIEDPHTAVASAVYHAYrkss-gdqsPTVIASTAS 426
gi 28211951  368 klnsfYSSFATdEETYEKLKEVYdk----ysYLMDTHTAVAYKVYEDYkkdt-gdkrKSIIASTAS 428
gi 23465602  369 irqifGTGWADeDQVRESIKHCWde----hhYVIDPHTACGYYLLEQMprd---pltPRVLLSTAS 427
gi 62511212  610 lqqdfVADWCSeGECLAAINSTYnt----sgYILDPHTAVAKVVADRVqdk----tcPVIISSTAH 667

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap