1I0Z,5MDH,1CIV,1EZ4,1GUZ,1HYH,1IB6,1OBB,1S6Y,1U8X,1UP7,1Y6J


Conserved Protein Domain Family
LDH_MDH_like

?
cd00650: LDH_MDH_like 
Click on image for an interactive view with Cn3D
NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family
Members of this family include ubiquitous enzymes like L-lactate dehydrogenases (LDH), L-2-hydroxyisocaproate dehydrogenases, and some malate dehydrogenases (MDH). LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. The LDH/MDH-like proteins are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Statistics
?
PSSM-Id: 133419
View PSSM: cd00650
Aligned: 14 rows
Threshold Bit Score: 163.259
Threshold Setting Gi: 31615790
Created: 7-Mar-2002
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 15 residues -Click on image for an interactive view with Cn3D
Feature 1:NAD(P) binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1              ## #                         ##                                          
1I0Z_A       23 ITVVGV-GQ-VGMACAISILgks-----ladELALVDVLe--dKLKGEMMDLQHGSlfl--qtpKIVADKd---YSVTAN 88
5MDH_A        6 VLVTGAaGQ-IAYSLLYSIGngsvfgkdqpiILVLLDITpmmgVLDGVLMELQDCAlpl---lkDVIATDk--eEIAFKD 79
1GUZ_A        3 ITVIGA-GN-VGATTAFRLAekq-----larELVLLDVVe--gIPQGKALDMYESGpvgl-fdtKVTGSNd---YADTAN 69
1IB6_A        3 VAVLGAaGG-IGQALALLLKtqlp----sgsELSLYDIAp---VTPGVAVDLSHIPta-----vKIKGFSgedaTPALEG 69
1OBB_B        6 IGIIGAgSAvFSLRLVSDLCktpg---lsgsTVTLMDIDe--eRLDAILTIAKKYVeevg-adlKFEKTMn--lDDVIID 77
1S6Y_A       10 IATIGGgSS-YTPELVEGLIkryhe--lpvgELWLVDIPegkeKLEIVGALAKRXVekag-vpiEIHLTLd--rRRALDG 83
1U8X_X       31 IVIAGGgST-FTPGIVLXLLdhlee--fpirKLKLYDNDk--eRQDRIAGACDVFIreka-pdiEFAATTd--pEEAFTD 102
1UP7_A        5 IAVIGGgSS-YTPELVKGLLdised--vridEVIFYDIDe--eKQKIVVDFVKRLVkd----rfKVLISDt--fEGAVVD 73
1Y6J_A       10 VAIIGA-GF-VGASAAFTMAlrq-----tanELVLIDVFk--eKAIGEAMDINHGLpfm---gqMSLYAGd---YSDVKD 74
gi 49035986   7 IVVIGA-SN-VGSAVANKIAdfq-----latEVVLIDLNe--dKAWGEAKDSSHATsciystniKFHLGD----YEDCKD 73
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1             ##                                             #                    ###   
1I0Z_A       89 SKIVVVTAgvrqqe--------------------------gesrlnLVQRNVnVFKFIIPQIVKys-pDCIIIVVSNPVD 141
5MDH_A       80 LDVAILVGsmprrd--------------------------gmerkdLLKANVkIFKCQGAALDKyakkSVKVIVVGNPAN 133
1GUZ_A       70 SDIVIITAglprkp--------------------------gmtredLLMKNAgIVKEVTDNIMKhs-kNPIIIVVSNPLD 122
1IB6_A       70 ADVVLISAgvarkp--------------------------gmdrsdLFNVNAgIVKNLVQQVAKtc-pKACIGIITNPVN 122
1OBB_B       78 ADFVINTAmvgghtylekvrqigekygyyrgidaqefnmvsdyytfSNYNQLkYFVDIARKIEKls-pKAWYLQAANPIF 156
1S6Y_A       84 ADFVTTQFrvgglearakderipl------kygvigqetngpgglfKGLRTIpVILDIIRDXEElc-pDAWLINFTNPAG 156
1U8X_X      103 VDFVXAHIrvgkyaxraldeqipl------kygvvgqetcgpggiaYGXRSIgGVLEILDYXEKys-pDAWXLNYSNPAA 175
1UP7_A       74 AKYVIFQFrpgglkgrendegipl------kygligqettgvggfsAALRAFpIVEEYVDTVRKt--sNATIVNFTNPSG 145
1Y6J_A       75 CDVIVVTAganrkp--------------------------getrldLAKKNVmIAKEVTQNIMKyy-nHGVILVVSNPVD 127
gi 49035986  74 ANIIVITAgpsirpg------------------------etpdrlkLAGTNAkIMSSVMGEIVKrt-kEAMIIMITNPLD 128
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                              #   #                             #                      
1I0Z_A      142 ILTYVTwkls----glpkHRVIGSGcnLDSARFRYLMAEKLgih-psSCH-GWILGEHGDs-sVAVWsGVNvagvslqel 214
5MDH_A      134 TNCLTAsksap---sipkENFSCLTr-LDHNRAKAQIALKLgvt-sdDVKnVIIWGNHSSt-qYPDVnHAKvklqakevg 207
1GUZ_A      123 IMTHVAwvrs----glpkERVIGMAgvLDAARFRSFIAMELgvs-mqDIN-ACVLGGHGDa-mVPVVkYTTvagipisdl 195
1IB6_A      123 TTVAIAaevlkkagvydkNKLFGVTt-LDIICSNTFVAELKgkq-pgEVE-VPVIGGHSGvtiLPLLsQVPgvsfteqev 199
1OBB_B      157 EGTTLVtrt-------vpIKAVGFX--HGHYGVMEIVEKLGle--eeKVD-WQVAGVNHG---IWLN-RFRynggnaypl 220
1S6Y_A      157 XVTEAVlry------tkqEKVVGLC--NVPIGXRXGVAKLLgvd-adRVH-IDFAGLNHX---VFGL-HVYldgvevtek 222
1U8X_X      176 IVAEATrrl------rpnSKILNIC--DXPVGIEDRXAQILglssrkEXK-VRYYGLNHF---GWWT-SIQdqegndlxp 242
1UP7_A      146 HITEFVrny------leyEKFIGLC--NVPINFIREIAEMFsar-leDVF-LKYYGLNHL---SFIE-KVFvkgedvtek 211
1Y6J_A      128 IITYMIqkws----glpvGKVIGSGtvLDSIRFRYLLSEKLgvd-vkNVH-GYIIGEHGDs-qLPLWsCTHiagkniney 200
gi 49035986 129 VATYVVstqf----dyprNLILGTGtmLETYRFRRILADKYqvd-pkNIN-GYVLGEHGNa-aFVAWsTTGcagfpiddl 201
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
1I0Z_A      215 npemgtdndsenwk------------------------------------------------------------------ 228
5MDH_A      208 vyeavkddswlkge------------------------------------------------------------------ 221
1GUZ_A      196 lpaetidklver-------------------------------------------------------------------- 207
1IB6_A      200 adltkriqn----------------------------------------------------------------------- 208
1OBB_B      221 ldkwieekskdwkpenpfndqlspaaidmyrfygvmpigdtvrnsswryhrdletkkkwygepwggadseigwkwyqdtl 300
1S6Y_A      223 vidlvahpdrsgvtxknivdlgwepdflkglkvlpcpyhryyfq-----------------------------------t 267
1U8X_X      243 klkehvsqygyipkteaeaveaswndtfakardvqaadpdtlpnty-------------------------------lqy 291
1UP7_A      212 vfenlklklsnipdedfptwfydsvrlivnpylryylm------------------------------------------ 249
1Y6J_A      201 iddpkcnfteedkk------------------------------------------------------------------ 214
gi 49035986 202 deyfhrteklshea------------------------------------------------------------------ 215
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                          #                            
1I0Z_A      229 ----------------------------evhkmvvesayeviklkgytnwaIGLSVADLIESMLkn----lsRIHPVSTM 276
5MDH_A      222 ----------------------------fittvqqrgaavikarklssamsAAKAICDHVRDIWfgt--pegEFVSMGII 271
1GUZ_A      208 -------------------------------trnggaeivehlkqgsafyaPASSVVEMVESIVld----rkRVLPCAVG 252
1IB6_A      209 ---------------------------------agtevveakagggsatlsMGQAAARFGLSLVralqgeqgVVECAYVE 255
1OBB_B      301 gkvteitkkvakfikenpsvrlsdlgsvlgkdlsekqfvlevekildperkSGEQHIPFIDALLnd----nkARFVVNIP 376
1S6Y_A      268 dkxlaeeleaaktkgtraevvqqlekelfelykdpnlaikppqlekrggayYSDAACSLISSIYnd----krDIQPVNTR 343
1U8X_X      292 ylfpddxvkksnpnhtranevxegreafifsqcdxitreqssenseikiddHASYIVDLARAIAyn----tgERXLLIVE 367
1UP7_A      250 -----ekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmYSTAAAHLIRDLEtd----egKIHIVNTR 320
1Y6J_A      215 ----------------------------kiaedvktagatiiknkgatyygIAVSINTIVETLLkn----qnTIRTVGTV 262
gi 49035986 216 -----------------------------veqelvqvaydvinkkgftntgIAMAACRFIKSVLyd----ehTILPCSAV 262
                       410       420       430       440       450
                ....*....|....*....|....*....|....*....|....*....|....*.
Feature 1                                                               
1I0Z_A      277 VKgmyg-ieneVFLSLPCILNARGltsVIN-QKLk--dDEVAQLKKSADTLWDIQK 328
5MDH_A      272 SDgnsygvpddLLYSFPVTIKDKTw-kIVEgLPIn--dFSREKMDLTAKELAEEKE 324
1GUZ_A      253 LEgqyg--idkTFVGVPVKLGRNGveqIYE-INLd--qADLDLLQKSAKIVDENCK 303
1IB6_A      256 GDgq-----yaRFFSQPLLLGKNGveeRKSiGTLs--aFEQNALEGMLDTLKKDIA 304
1OBB_B      377 NKgiihgidddVVVEVPALVDKNGi-hPEKiEPPlpdrVVKYYLRPRIMRMEMALE 431
1S6Y_A      344 NNgaiasisaeSAVEVNCVITKDGp-kPIA-VGDlp-vAVRGLVQQIKSFERVAAE 396
1U8X_X      368 NNgaianfdptAXVEVPCIVGSNGp-ePIT-VGTip-qFQKGLXEQQVSVEKLTVE 420
1UP7_A      321 NNgsienlpddYVLEIPCYVRSGRv-hTLS-QGKgd-hFALSFIHAVKMYERLTIE 373
1Y6J_A      263 INgmyg--iedVAISLPSIVNSEGvqeVLQ-FNLt--pEEEEALRFSAEQVKKVLN 313
gi 49035986 263 LEgeyg--ikdVALSIPRMVCADGimrSFE-VHLt--dDELEKMHKAAQSVRSALD 313

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap