1EXI


Conserved Protein Domain Family
HTH_BmrR

?
cd01107: HTH_BmrR 
Click on image for an interactive view with Cn3D
Helix-Turn-Helix DNA binding domain of the BmrR transcription regulator
Helix-turn-helix (HTH) multidrug-efflux transporter transcription regulator, BmrR and YdfL of Bacillus subtilis, and related proteins; N-terminal domain. Bmr is a membrane protein which causes the efflux of a variety of toxic substances and antibiotics. BmrR is comprised of two distinct domains that harbor a regulatory (effector-binding) site and an active (DNA-binding) site. The conserved N-terminal domain contains a winged HTH motif that mediates DNA binding, while the C-terminal domain binds coactivating, toxic compounds. BmrR shares the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.
Statistics
?
PSSM-Id: 133382
View PSSM: cd01107
Aligned: 60 rows
Threshold Bit Score: 112.997
Threshold Setting Gi: 42521663
Created: 30-Apr-2009
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 7 residues -Click on image for an interactive view with Cn3D
Feature 1:DNA binding residues [nucleic acid binding site]
Evidence:
  • Structure:1EXI; Bacillus subtilis BmrR bound to DNA; defined at 3.5A contacts.
    View structure with Cn3D
  • Comment:these residues contact two consecutive major grooves

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         ###             #                 ###                                          
1EXI_A         6 YSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPdtSYRYYTdSQLIHLDLIKSLKY-IGTPLEEMKKAQDLEme----eL 80
gi 115252678   2 FSIGMFSKINKITTKTLRYYEDIGLLKPEYVDEftKYRYYTtEQLPKLHQIITLKQ-MGLSLAEIKKAVENPe-----eV 75
gi 113939930   2 LRIGAFSRIAHMTIDTLRHYDAVGLLKPAVIDPttGYRYYTaDQLQAVNQIVTLKE-LGFSLEEIAHIQKGHsss--adL 78
gi 82745161    5 YTIGEVSRYMNISTKILRHYDHLNLLKPCYISPdtKYRYFSyDQLFIIDVIRYLNKtLLIPLEDIKNILDENkdy--dkL 82
gi 106884917  13 FKIGEVAAMFDISTKTLRIYDRIGLLKPSSIDGesGYRYYSpNQISRLEVILNLKR-VGFSLSEISLFVNGDisn--neI 89
gi 28211129   10 YSIGKVGEICKITKKALRYYDKMDILSPDKVSDesGYRYYSkKTLLSVPMIKYYKQ-SGFKLEEMKVFLEGEty---dfF 85
gi 106884871   7 YSIGEVSKSCNISTKALRFYDKMGIISPDVICKenSYRYYNkESLLTVPIVKYYKQ-MGFKLEEMQGLVEGNty---fyL 82
gi 78358331    7 YSIGDVSQICNISKKALRYYDKIGLITSQRQDYn-NYRYYThESLLAVPVIKYYKQ-MGFKLDEMREFIEGStanvyraI 84
gi 67078194    2 YTIGKFSGICNLPVKTLRYYDDIGLLKPSYIDPktNYRYYDyDKIEAIKIIMLLKS-LHTPLADIKEIIERVdq---vqW 77
gi 47496506   50 YSIGKVSTLCNVPIKTLRYYDKIGLLVPEYRKCdsNYRYYTqDQILTLFIIRKLKH-LGIPLKDISQIVCKKna---saM 125
                         90       100       110
                 ....*....|....*....|....*....|..
Feature 1                                        
1EXI_A        81 FAFYTEQERQIREKLDFLSALEQTISLVKKRM 112
gi 115252678  76 ENILMNKEKEMLDVIKSEEYKIIKLRNYLMNL 107
gi 113939930  79 HALLQHQLRVTEQTITAAEQRRSRIQAHLHAV 110
gi 82745161   83 LTFLESHKEQLDKKIADIEYSKQLTDSMISDI 114
gi 106884917  90 ATIFRKKHTQLQSMVDSLEYNMELIEDMISSL 121
gi 28211129   86 HKSFRNKIDELKELEKEINLKIRSVKDWDDLI 117
gi 106884871  83 EHNFRNKIDQLRLQEQQIHNSYIAVKDWYELI 114
gi 78358331   85 RNSFLSKIQELEKEQEEIRRKHMSVKDWYDLI 116
gi 67078194   78 NSIFEQKISELEKQKEQISKEIEEIKQLQIKM 109
gi 47496506  126 GACIRERLYEISNAIDSLNNQYAEGQLLLERL 157

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap