Conserved Protein Domain Family
HTH_SoxR

?
cd01110: HTH_SoxR 
Helix-Turn-Helix DNA binding domain of the SoxR transcription regulator
Helix-turn-helix (HTH) transcriptional regulator SoxR. The global regulator, SoxR, up-regulates gene expression of another transcription activator, SoxS, which directly stimulates the oxidative stress regulon genes in E. coli. The soxRS response renders the bacterial cell resistant to superoxide-generating agents, macrophage-generated nitric oxide, organic solvents, and antibiotics. The SoxR proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the unusually long spacer between the -35 and -10 promoter elements. They also harbor a regulatory C-terminal domain containing an iron-sulfur center.
Statistics
?
PSSM-Id: 133385
View PSSM: cd01110
Aligned: 31 rows
Threshold Bit Score: 208.972
Threshold Setting Gi: 54025303
Created: 30-Apr-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:DNA binding residues [nucleic acid binding site]
Evidence:
  • Comment:Based on sequence similarity to BmrR and the structure of Bacillus subtilis BmrR bound to DNA (1EXI).

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1          ###             #               ###                                           
gi 2495412     9 ELSVGELARRAGVAVSALHFYETKGLISSQRNAGNQRRFSRETLRRVVVIKVAQRVGIPLAEIARALQTLPAGRSPSAAD 88
gi 4218552    12 ELTVGQLSARSGVAVTALHFYESKGLIKSRRTPGNQRRYTRDTLRRISVIRVAQRMGIPLSTVAEALAELPEERTPTRED 91
gi 14571595   11 DLTVGELSRRSGVPASALRFYEDEGLIHSRRTAGNQRRYRRDTLRRVTFIRMSQRVGMPLSKIREVLGLLSDDRTPTRTD 90
gi 3820507     5 TITIGRLAKRTGVAASALRFYEARGLIHSVGEAGKTRRYRRDAIRRVSFIRVAQAMGMSLQDIGAALADLPSQRTPTADD 84
gi 117559490   5 WLAIGQIAKRSGVKASALRFYEQKGLIGSVRSEGGQRLYPQDVLRRIAFIRVAQGMGLSLGEIGEALAGLPEGRTPDRRD 84
gi 111224992   6 LLTVGELSRRSGFAPSALRFYERQGLLAATRTAGGQRRYERHVLRRLAFIRAATAMGLSLDEVAQALASLPDARTPTKAD 85
gi 56695229    6 GLSIGALARRTGLAVSAIRYYETQGLIAPWRNAGGQRRYQRADLRRLSFVMIAQQLGLTLPEIREVLAGLPGNRTPTRGD 85
gi 114798478   8 ILTIGELAARTGVAVSALRYYEERGLVRSLRAKGQHRRFLRSDIRRVSFIRIAQSLGLTIEDVAQAFAALPEGRTPTAAD 87
gi 115358879  11 LMSIREVAARSGVPASTLRFYETRGLIKSHRNGSSHRHYSRAVLRLIAFIVFAQKIGYSLDEIAEQLVSLPEDTAPTNKD 90
gi 83950354   10 ALSIGSISDRTGLAPSAIRYYEDEGLIAPGRNASGHRRYARSDIRRLSFVQISQGLGFTIAEIREALSSLPADRAPTKAD 89
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*....
Feature 1                                                                   
gi 2495412    89 WARLSAQWKEDLTERIDKLLLLRDQLDGCIGCGCLSLQACPLRNPGDQLSAEGPGAHWL 147
gi 4218552    92 WARLSRRWRADLNERIEQLLALRDGLEDCIGCGCLSVRDCPLTNPYDELGEEGPGPRRL 150
gi 14571595   91 WARISRCWQDDLNARIRQMEQLRDQLDDCIGCGCMSLAKCRLANPGDRLGTDGPGPRRL 149
gi 3820507    85 WARISQAWKPLLQERIEALCRLRDQLDSCIGCGCLSLERCKLYNPDDKAGEQGCGPRFL 143
gi 117559490  85 WDGIASQWQSLLDRRITALQQLQEKLGACIGCGCLSLEHCALYNPDDQAARQGEGPRYL 143
gi 111224992  86 WSAISRRWRTRLDEEIAALEALRDGLDSCIGCGCLSLRRCRISNPADRIGALGPGARAL 144
gi 56695229   86 WTRISTALRERLNQRIATLERLRDNLDGCIGCGCLSLPNCALYNPADRVGSKGPGPRLV 144
gi 114798478  88 WRAISGDIRGVLDRKIAELENMRDKLDNCIGCGCLSLKRCALYNAGDEAGKTGTGPRFI 146
gi 115358879  91 WQRLSRGWKQRVANRIEELQRLYINLDECIGCGCLSLKRCKLTNPEDRAGRNGPGARRW 149
gi 83950354   90 WSRISRRFGAELDARIARMQLLRTKLDSCIGCGCLSLKTCALYNPRDRAKRLGSGPRYL 148

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap