1AQ6,4EGC,3NUQ,4FYP,2JCM,2HCF,2B0C,1SWW,2FUE,1RKV,1U7P,2B82,1YNS,1K1E,2FPU,3KC2,2HX1,1YMQ,2HO4,2FEA,1L8L,1F5S,3FVV,3U7H,3B8C,1Z4I,1RKQ,2OYC,1RLO,1XVI,1U02,1S2O,1KYT,2G07,1RC8,2FDR,1T9Z,2HI0,2YY6,2FI1,2I33,2PKE,2HSZ,2AH5,2HDO,4QJB,1Y8A,2FPU,4RN3,3S6J,1QYI,4B6J,3KZX,3M9L,3WGU,3K1Z,2W4M,4EX6


Conserved Protein Domain Family
HAD_like

?
cd01427: HAD_like 
Click on image for an interactive view with Cn3D
Haloacid dehalogenase-like hydrolases
The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others. This superfamily includes a variety of enzymes that catalyze the cleavage of substrate C-Cl, P-C, and P-OP bonds via nucleophilic substitution pathways. All of which use a nucleophilic aspartate in their phosphoryl transfer reaction. They catalyze nucleophilic substitution reactions at phosphorus or carbon centers, using a conserved Asp carboxylate in covalent catalysis. All members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. Members of this superfamily are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.
Statistics
?
PSSM-Id: 319763
View PSSM: cd01427
Aligned: 161 rows
Threshold Bit Score: 29.2862
Threshold Setting Gi: 28373512
Created: 13-Dec-2003
Updated: 18-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 12 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Structure:1K1E: Haemophilus influenzae deoxy-D-mannose-octulosonate 8-phosphate phosphatase (YrbI) binds Co2+ and sulfate ion in the active site
    View structure with Cn3D
  • Structure:1YNS: human enolase-phosphatase E1 (MASA), binds a substrate analog 2-oxoheptylphosphonic acid and Mg2+ in the active site
    View structure with Cn3D
  • Structure:1RKV: Pseudomonas aeruginosa ThrH binds phosphate and two Mg2+ ions in the active site
    View structure with Cn3D
  • Structure:1U7P: mouse phosphotyrosine phosphatase MDP-1 binds Mg2+ in the active site
    View structure with Cn3D
  • Structure:2FPU: Escherichia coli Hisb-N binds histidinol and Mg2+ in the active site
    View structure with Cn3D
  • Structure:2B82: Escherichia coli acid phosphatase AphA binds adenosine, phosphate, and Mg2+ in the active site
    View structure with Cn3D
  • Structure:3WGU: pig Na(+)/K(+)-ATPase (preceding the E1P state) binds Mg(2+)-ADP-AlF4(-) in the active site
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1            #####                                                                       
1AQ6_A         4 AVVFDAYGTLFdvqsvadateraypgrgeyitqvwrqkqleyswlralmgryadfwgvtrealaytlgtlglepdesfla 83
1K1E_A        10 FVITDVDGVLTdgqlhydang----------------------------------------------------------- 30
3FVV_A         6 LALFDLDHTLLpldsdyqwadflartgragdpaearrrnddlmerynrgel---taeqaaefmlgllaahspvelaawhe 82
1XVI_A        11 LVFSDLDGTLLdshsy---------------------------------------------------------------- 26
1S2O_A         5 LLISDLDNTWVgdqq----------------------------------------------------------------- 19
1KYT_A         7 LAAIDVDGNLTdrdrl---------------------------------------------------------------- 22
gi 166154324   6 LLVTDIDGTIThqshl---------------------------------------------------------------- 21
gi 22536947    5 RIFCDMDGTLLnsegq---------------------------------------------------------------- 20
gi 15672226    6 HIFSDLDGTLLddqgk---------------------------------------------------------------- 21
gi 15674125    5 HIFTDMDGTLLdshgs---------------------------------------------------------------- 20
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                        ##                                              
1AQ6_A        84 dmaqaynrltpypdAAQCLAELap--lKRAILSNgapDMLQALvanagltdsfdAVISvdak------------------ 143
1K1E_A        31 -----eaiksfhvrDGLGIKMLmdadiQVAVLSGrdsPILRRRiadl----gikLFFLgk-------------------- 81
3FVV_A        83 efmrdvirpsltvqAVDVVRGHlaagdLCALVTAtnsFVTAPIaraf----gvqHLIAtdpeyrdgrytg---------- 148
1XVI_A        27 ----------dwqpAAPWLTRLreanvPVILCSSktsAEMLYLqktlg--lqglPLIAengaviqlaeqwqeidgfprii 94
1S2O_A        20 ----------alehLQEYLGDRrg-nfYLAYATGrsyHSARELqkqvg-lmepdYWLTavgseiyhpegldqhwadylse 87
1KYT_A        23 ----------istkAIESIRSAekkglTVSLLSGnviPVVYALkifl---gingPVFGenggixfdndgsikkffsnegt 89
gi 166154324  22 ----------lhdrVVKALHQYydsgwQLFFLTGryfSYAYPLfqnf---svpfLLGSqngssvwsstdkefiyfrslsr 88
gi 22536947   21 ----------vsksNATLIREAa---iPVTLVSArapMEMKDAvdal---qlggVQVAfnggliyrigdnnqvlpihtqi 84
gi 15672226   22 ----------iskkTQEVIENSn---lPFSLVSArapQAMESLinql---nlksSQVAfngglifaknevikanpmvhas 85
gi 15674125   21 ----------vsdtNHWSIYYSd---lPITLVSArspLEMSNIvekl---qlrtPQIAfngnltftqnqfglqiidknpl 84
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1AQ6_A           --------------------------------------------------------------------------------
1K1E_A           --------------------------------------------------------------------------------
3FVV_A           --------------------------------------------------------------------------------
1XVI_A        95 sgishgeislvlntlrekehfkfttfddvddatiaew--------------------------tglsrsqaaltqlheas 148
1S2O_A        88 hwqrdilqaiadgfealkpqspleqnp----------------------------------------------wkisyhl 121
1KYT_A        90 nkfleexskrtsxrsiltnrw---------------------------------------------------------re 112
gi 166154324  89 dflcvlekyfedldliaciesgasnrdvyfrkglgktsqelkaildavyfptpeaarllvdvqghlseefsyedfaiakf 168
gi 22536947   85 ikkstvkqllrgirfhfpqvslsyydlnnwycdkidegiryehslt-------qqcptfihnedqfleghtntfkimmit 157
gi 15672226   86 aqeliktikkdypeinlslyslsdwyvekidkdieqemqftpqv-----------pklvdletliterprleifkillit 154
gi 15674125   85 asetvsqllnyistefpnvslnwyslahwyinkqdkgtfiqka-------------itgiepkiktfdgqseiykimmiv 151
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                 #                             ##  ##   
1AQ6_A       144 --------------------------------------rvfKPHPDSyalveev------lgvtpaeVLFVSSnGFDVGG 179
1K1E_A        82 ---------------------------------------leKETACFdlmkqa--------gvtaeqTAYIGDdSVDLPA 114
3FVV_A       149 ------------------------------riegtpsfregKVVRVNqwlagmgl-----algdfaeSYFYSDsVNDVPL 193
1XVI_A       149 vtliwrdsdermaqftarlnelglqfmqgarfwhvldasagKDQAANwiiatyqq-----lsgkrptTLGLGDgPNDAPL 223
1S2O_A       122 dpqacptvidqltemlketgipvqvifssgkdvdllpqrsnKGNATQylqqhl--------amepsqTLVCGDsGNDIGL 193
1KYT_A       113 astgfdidpedvdyvrkeaesrgfvifysgyswhlxnrgedKAFAVNklkexy--------sleydeILVIGDsNNDXPX 184
gi 166154324 169 fgereevkkimdrfiqspevssqvtmnymrwpfdfkyavllLTLKDVskgfavdqvvqtfykenkpfIMASGDdVNDIDL 248
gi 22536947  158 fdeanmlelekylqslelpeitiqrsgkayleithllakksKGIAYIlqkeq----------lareeTAAFGDgHNDLPM 227
gi 15672226  155 pneskleeikkhleklnfpdiiiqktwetyleithleaqkaKAVQFIaqreq----------leqseLAAFGDnENDLSM 224
gi 15674125  152 fdsqellqlqaqlnnlnipnisvqqsgqwyleitsdnktkaDAVQSIldnkn----------ldfqeIAAIGDgHNDIPL 221
                        330
                 ....*....|.
Feature 1                   
1AQ6_A       180 AKnfgfSVARV 190
1K1E_A       115 FAac-gTSFAV 124
3FVV_A       194 LEav-tRPIAA 203
1XVI_A       224 LEvm-dYAVIV 233
1S2O_A       194 FEts-aRGVIV 203
1KYT_A       185 FQlp-vRKACP 194
gi 166154324 249 LSrg-dFKIVI 258
gi 22536947  228 LEmv-gYPIVM 237
gi 15672226  225 LKav-gLPIVM 234
gi 15674125  222 LQsa-gLAIAV 231

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap