Conserved Protein Domain Family
P-type_ATPase_APLT_Dnf-like

?
cd02073: P-type_ATPase_APLT_Dnf-like 
Aminophospholipid translocases (APLTs), similar to Saccharomyces cerevisiae Dnf1-3p, Drs2p, and human ATP8A2, -10D, -11B, -11C
Aminophospholipid translocases (APLTs), also known as type 4 P-type ATPases, act as flippases, and translocate specific phospholipids from the exoplasmic leaflet to the cytoplasmic leaflet of biological membranes. Yeast Dnf1 and Dnf2 mediate the transport of phosphatidylethanolamine, phosphatidylserine, and phosphatidylcholine from the outer to the inner leaflet of the plasma membrane. This subfamily includes mammalian flippases such as ATP11C which may selectively transports PS and PE from the outer leaflet of the plasma membrane to the inner leaflet. It also includes Arabidopsis phospholipid flippases including ALA1, and Caenorhabditis elegans flippases, including TAT-1, the latter has been shown to facilitate the inward transport of phosphatidylserine. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.
Statistics
?
PSSM-Id: 319770
View PSSM: cd02073
Aligned: 34 rows
Threshold Bit Score: 683.899
Threshold Setting Gi: 24642515
Created: 15-Dec-2004
Updated: 18-Aug-2016
Structure
?
Aligned Rows:
 
Feature 1: P-type ATPase signature motif, 7 residue positions
Conserved feature residue pattern:D K [TS] G T [LIVM] [TS]Click to see conserved feature residue pattern help
Evidence:
  • Comment:a characteristic P-type ATPase conserved sequence motif: DK[TS]GT[LIVM][TS], in which D is the reversibly phosphorylated Asp

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 30316390   30 DNQISTAKYSVLTFLPRFLYEQIRRAANAFFLFIALLQqipdvSPTGRYTTLVPLIIILTIAGIKEIVEDFKRHKADNAV 109
gi 31340488  233 QNSIVSSRYNKYNFVPLQIIAQFSKTANCYFLLIAIMQmipgwSTTGTYTTIIPLLIFISIAILREGFDNYRRYRQDRVE 312
gi 34811819   57 SNFIRTSKYTLISFLPLSLLLEFKKVSNLYFLMNVIFSlipgvSPLSPATSIAPLSFVLIVALIKEGVEDIKRHQADNRA 136
gi 30316395   41 DNRIISSKYTVWNFVPKNLFEQFRRVANFYFLIIFLVQlm-idTPTSPVTSGLPLFFVITVTAIKQGYEDWLRHNSDNEV 119
gi 32449679   42 DNRIVSSKYTVWNFIPKNLFEQFRRIANFYFLIIFLIQai-vdTPTSPVTSGLPLFFVITVTAIKQGYEDWLRHRADHEV 120
gi 40316839   45 DNRIVSSKYTLWNFLPKNLFEQFRRIANFYFLIIFLVQvt-vdTPTSPVTSGLPLFFVITVTAIKQGYEDWLRHRADNEV 123
gi 24642513   27 LNRVTTTKYTWFTFLPLNFYEQFRRAVYFYFLIITIVSff-vnETISPLVSLLPLLFVMIITALKEGLEDYSRSKSDKLV 105
gi 2493011   140 DNRITSSRYTFYSFLPRQLYAQFSKLANTYFFIVAVLQmipgwSTTGTYTTIIPLCVFMGISMTREAWDDFRRHRLDKEE 219
gi 56474175   41 GNKVSTTKYSIISFLPLFLYNQFKHVTNIYFLLVAIISlipqiSATNPITNVLPLVFVLCVSGIKEIIEDIRRWIADRGF 120
gi 27802717   33 DNRIVSSKYTVWNFLPKNLFEQFRRIANFYFLIIFLVQvi-vdTPTSPVTSGLPLFFVITVTAIKQGYEDWLRHKADNEV 111
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 30316390  110 N---KKKTIVLRNGm----------------------------------------------------------------- 121
gi 31340488  313 N---RIQTQVLRHVdvdppiveehssffrrrrwrrsrsqesasrstirstderepertsedppqlppspsspsspalsvk 389
gi 34811819  137 N---SILVQVLRNGk----------------------------------------------------------------- 148
gi 30316395  120 N---GAPVYVVRSGg----------------------------------------------------------------- 131
gi 32449679  121 N---KSTVYIIEGSk----------------------------------------------------------------- 132
gi 40316839  124 N---KSTVYIIENAk----------------------------------------------------------------- 135
gi 24642513  106 N---TARVTVIRNGk----------------------------------------------------------------- 117
gi 2493011   220 N---NKPVGVLVKDgnndaqevytlpssvvsstayltksaaaennp--------------------------plnddrns 270
gi 56474175  121 NnakYTRVNVSDGN------------------------------------------------------------------ 134
gi 27802717  112 N---KYPVTVLEDGr----------------------------------------------------------------- 123
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 30316390  122 -----------------------WHTIMWK-----EVAVGDIVKVVNGQYLPADVVLLSSSEpqAMCYVETANLDGETNL 173
gi 31340488  390 pnidpqpplynstltttrsipanKPTFFWAscdrkDVRVGDIIRLTSDQTLPADVIALSSPNpnGAIYIETAALDGETSL 469
gi 34811819  149 -----------------------LVSVHSK-----DIHPGDVMRIKNGEEVRADVVMLASSVeeGQAFIDTCNLDGETNL 200
gi 30316395  132 -----------------------LVKTRSK-----NIRVGDIVRIAKDEIFPADLVLLSSDRldGSCHVTTASLDGETNL 183
gi 32449679  133 -----------------------CVKKESE-----KIKVGDIVEVRDNETFPCDLVMLSTSCrdGTCTVTTASLDGESNF 184
gi 40316839  136 -----------------------RVRKESE-----KIKVGDVVEVQADETFPCDLILLSSCTtdGTCYVTTASLDGESNC 187
gi 24642513  118 -----------------------EEIINSQ-----FIVPGDLVVVRNDGDVPCDLVLLQSSSadRKCFVNTANLDGETNL 169
gi 2493011   271 sqghfldthfnnfellknkynvhIHQKKWE-----KLRVGDFVLLTQDDWVPADLLLLTCDGenSECFVETMALDGETNL 345
gi 56474175  135 -----------------------LISITSA-----EVRTGYVLELKTNDRIPADCIPLSSSNddGIVFVQTAALDGETNL 186
gi 27802717  124 -----------------------SVKKESE-----KIKVGDVVEVVEDETFPCDLILLQSSRedGTCFVTTASLDGESNH 175
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 30316390  174 KIRqgl-shTADMQTREVLMKLsgTIECEGPNRHLYDFTGNLNldgk---------slvALGPDQILLRGTQLRNTQWVF 243
gi 31340488  470 KTRlvnstlRSLCKDINDLIRLsgTCTVEDPNGDLYNFNGSMKldsi--------qgeiPLSNNDVLYRGSNLRNTSELF 541
gi 34811819  201 KSRkal-eaTWALCEVEAIMNStaVLHTSKPDPGLLSWAGLLEing----------eehALSLNQFLYRGCVLRNTDWVW 269
gi 30316395  184 KTHvav-peTALLQTVANLDTLvaVIECQQPEADLYRFMGRMIitqqm------eeivrPLGPESLLLRGARLKNTKEIF 256
gi 32449679  185 KTYhav-peTAIMGSYEDLNAFsaTIECEQPQPDLYKFHGRIDvntnq------dvkarSLGPENLLLKGATLKNTKKIY 257
gi 40316839  188 KTHyav-rdTIALCTAESIDTLraAIECEQPQPDLYKFVGRINiysnsl-----eavarSLGPENLLLKGATLKNTEKIY 261
gi 24642513  170 KTIcv---pTNYLLAGDHELQGkdCIVCEPSSADLYTFNGRLElrsgndgagssagdalPLTIDNLLLRGVRVKSTERVV 246
gi 2493011   346 KSKqphpelNKLTKAASGLANInaQVTVEDPNIDLYNFEGNLElknhrn----dtimkyPLGPDNVIYRGSILRNTQNVV 421
gi 56474175  187 KEVf-----VPKDLNNIDTLKMvgTMHCNPPNEYFNQYNATISiqdeng-----stkdiPVSAANLLIGGAVIKDTEKCT 256
gi 27802717  176 KTH------YTVPDIERDLQVLtaAIECEQPQPDLYKFVGRMHiykpeq-----eeavrSLGPENLLLKGATLKNTKEIY 244
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 30316390  244 GIVVYTGHDTKLMQNSTKAp-lKRSNVEKVTNVQILVLFGILLVMALVSSAGALywnrshgeknwyikk------mdtts 316
gi 31340488  542 ALVIFTGEESKIRMNAVRNvsvKAPSMQKVTNRIVIFIFALVVSMAIYCTAAYFvwqkkverklwyl---------tnsk 612
gi 34811819  270 GMVAYAGVDTKLFRNLKPKp-pKSSNLDRKLNYFIIAILIFQNIMLFILASMAVwwnskyretpylrffi----sfrknv 344
gi 30316395  257 GVAVYTGMETKMALNYKSKs-qKRSAVEKSMNTFLIIYLVILISEAVISTILKYtwqaeekwdepwynqktehqrnsski 335
gi 32449679  258 GVAVYTGMETKMALNYQGKs-qKRSAVEKSINAFLIVYLCILVSKATICTSLKYlwqsnpandepwyndktrkekeafki 336
gi 40316839  262 GVAVYTGMETKMALNYQGKs-qKRSAVEKSINAFLIVYLFILLTKAAVCTTLKYvwqstpyndepwynqktqkeretlkv 340
gi 24642513  247 GCAIYTGMHTKLQLNSRYTg-nKSASSEKYINRFMVALIVGMIVVVVVLYLIERhkeakivptmpyqgpp----tnfnsa 321
gi 2493011   422 GMVIFSGEETKIRMNALKNprtKAPKLQRKINMIIVFMVFVVATISLFSYLGHVlhkkkyidqnkawy-------lfqad 494
gi 56474175  257 ALVCHCGKHSKLALNQPSLr-tKFAHTDARMNQFVFGIFCFKIVIVIVATIAGSlflvrtgrdswyldm-----edisvg 330
gi 27802717  245 GVAVYTGMETKMALNYQGKs-qKRSAVEKSINAFLLVYLCILISKAVVCTTLKYvwqskegqdepwynektqkeketnmy 323
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                      ##
gi 30316390  317 dnfgynlltFIILYNNLIPISLLVTLEVVKYTQALFINWDTDmyyig-------ndtpaMARTSNLNEELGQVKYLFSDK 389
gi 31340488  613 lsfvpilvsFIILYNTMVPISLYVSMEIIRVFQTFLVQSDIDlyype-------ndtrcEVRSSSILEELGQVTHVFSDK 685
gi 34811819  345 tlwgyrylsYFILLSYCVPISLFITIEVCKVVQAQWMRVDCLmmeyms-----nrwrhcQPNTSNLNEQLAMVRFIFSDK 419
gi 30316395  336 lrfisdflaFLVLYNFIIPISLYVTVEMQKFLGSFFIGWDLDlyhee-------sdqkaQVNTSDLNEELGQVEYVFTDK 408
gi 32449679  337 lkmftdflsFMVLFNFIIPVSMYVTVEMQKFLGSFFIAWDMEmfdke-------inegaLVNTSDLNEELGQVEYVFTDK 409
gi 40316839  341 lkmftdflsFMVLFNFIIPVSMYVTVEMQKFLGSFFISWDKDfydee-------inegaLVNTSDLNEELGQVDYVFTDK 413
gi 24642513  322 wqifedflsFLLLFNYMVPISAYMNIEVYRIFGMHFMHNDLHlydee-------tdqpcRVNASNLNEELGQVNILFSDK 394
gi 2493011   495 agvaptimsFIIMYNTVIPLSLYVTMEIIKVVQSKMMEWDIDmyhae-------tntpcESRTATILEELGQVSYIFSDK 567
gi 56474175  331 knavqtffrYFGLLSYLIPISCAVSLEVAKFIQTMLMECDTDfniynidedgqlvtekmAAKTSILNDELALVEYVLSDK 410
gi 27802717  324 lkmftdflsFMVLFNFIIPVSMYVTVEMQKFLGSFFIKWDNDffdpe-------ieegaLVNTSDLNEELGQVEYVFTDK 396
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #####                                                                           
gi 30316390  390 TGTLTCNIMNFKKCSIAGVTYGhfpelarepssddfcrmpppcsds---------------------------------- 435
gi 31340488  686 TGTLTDNIMLFRNLSVGGFAWQhvgaenpklvstsqksddldgeakppql------------------------------ 735
gi 34811819  420 TGTLTENVMKFKLGDALGNPIDadnldeciaqlrk--------------------------------------------- 454
gi 30316395  409 TGTLTENEMQFRECSINGMKYQeingrlvpegptpdssegnlsylsslshl----------------------------- 459
gi 32449679  410 TGTLTENKMEFIECCIDGHKYAntdvmdglpltdgl-------------------------------------------- 445
gi 40316839  414 TGTLTENSMEFIECCIDGHKYKgvtqevdglsqtdgt------------------------------------------- 450
gi 24642513  395 TGTLTKNLMKFVNCYVPGTNYQlqnthlvsegtde--------------------------------------------- 429
gi 2493011   568 TGTLTDNKMIFRKFSLCGSSWLhnvdlgnsednfednrdntnslrlppkahngssidvvsigdqnvldrlgfsdapiekg 647
gi 56474175  411 TGTLTENSMVFKMASVDGEVIEgkkleenfklywnidkekngmevmdkrn------------------------------ 460
gi 27802717  397 TGTLTQNNMEFIECCIDGFQYRhrdahgeldgftvtdg------------------------------------------ 434
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 30316390  436 -----------------------------------------------------------cdfddprllkniedrhptapc 456
gi 31340488  736 -------------------------------------------------------eniqgttiqllqyvhdnphttfskr 760
gi 34811819  455 -----------------------------------------------------------------------eaeskglgp 463
gi 30316395  460 -------------------------------------------------------nnlshlttsssfrtspenetelike 484
gi 32449679  446 ----------------------------------------------------------------------vcfgkasqdr 455
gi 40316839  451 ---------------------------------------------------------------------ltyfdkvdknr 461
gi 24642513  430 ----------------------------------------------------------------------kfelekldad 439
gi 2493011   648 hrpsldnfpksrnsieykgnssaiytgrpsmrslfgkdnshlskqasvispsetfsenikssfdliqfiqryptalfsqk 727
gi 56474175  461 --------------------------------------------------------edinyvsdtkvtmkegvdevkaqa 484
gi 27802717  435 -------------------------------------------------------------------plnklqekagrek 447
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 30316390  457 iqeFLTLLAVCHTVVPekdg---------------------dniiYQASSPDEAALVKGAKKLGFVFTartpf------- 508
gi 31340488  761 vriFLLNLAICHTCLPsfdee-------------------nqiykYQSISPDELALVHAAQQLGYIVIdrdidsltirlh 821
gi 34811819  464 lqeYFLALALCNTVQPfkddtd------------------dlgvvYEGSSPDEVALVETAAAVGYRLIsrttks------ 519
gi 30316395  485 hdlFFKAVSLCHTVQIsnvqtdctgdgp------wqsnlapsqleYYASSPDEKALVEAAARIGIVFIgnsee------- 551
gi 32449679  456 eelFLRALCLCHTVQMkeechtdgp-----------sfsstdncaYISSSPDEIALVTGAKRYGFTYMgtennf------ 518
gi 40316839  462 eelFLRALCLCHTVEIktndavdg-------------atesaeltYISSSPDEIALVKGAKRYGFTFLgnrngy------ 522
gi 24642513  440 aavLFEALAVCHTVEVlqevgdktlessesvseqshlmsrnivdrYQASSPDEKALLEGCASLGLVYEgqendv------ 513
gi 2493011   728 akfFFLSLALCHSCLPkkthnes---------------igedsieYQSSSPDELALVTAARDLGYIVLnrnaqilti-kt 791
gi 56474175  485 ikdYLLALAICNEARPkkeg---------------------dkinYQSQSPDEVALCQQAVDSNVLFFkrtqt------- 536
gi 27802717  448 eelFLRALCLCHTVQVkee------------------------tlSDQIDGIDGVLPKAEEERGFIASspd--------- 494
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 30316390  509 -sviieAMGQEQTFGILNVLEFSSDRKRMSVIVRtps--grLRLYCKGADNVIFERLskds------------------- 566
gi 31340488  822 ypldphSHPIAKTYRILNIIEFTSKRKCMSVIVRmpn--grICLFCKGADSAIIKRLrlsnlakrkdksvtkaeqarksi 899
gi 34811819  520 -itlllHDGTRKVYNILATLEFTPDRKMMSIIVEdsd-tkkITLYNKGADSFIRPQLsr--------------------- 576
gi 30316395  552 -tmevkTLGKLERYKLLHILEFDSDRRRMSVIVQaps--geKLLFAKGAESSILPKCigg-------------------- 608
gi 32449679  519 -msvrnQKDEIERYQLLHVLHFDPVRRRMSVLVKant--gkIFLFCKGADSSMFPRVard-------------------- 575
gi 40316839  523 -mrvenQRKEIEEYELLHTLNFDAVRRRMSVIVKtqe--gdILLFCKGADSAVFPRVqnh-------------------- 579
gi 24642513  514 lsicryPSAEKVQFKRLHVLEFSSERQRMSVIVRdqs--dtIWLYSKGAESAIFPRCkasp------------------- 572
gi 2493011   792 fpdgfdGEAKLENYEILNYIDFNSQRKRMSVLVRmpnqpnqVLLICKGADNVIMERLhdrelaakkmadictstkerkda 871
gi 56474175  537 -mlyvsLFGEILEFKILAIFSFNSDRKRQSVIVQthe--gqIIMYTKGADSIIASRMihed------------------- 594
gi 27802717  495 ---evaLVKGAMEYKLLHVLNFDPVRRRMSVIVQtks--gdTLLFCKGADSSIFPRV----------------------- 546
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 30316390      --------------------------------------------------------------------------------
gi 31340488  900 eidkaiirnsqstsrpsltasrpslsrrrndyinnvtswlder------------------------------------- 942
gi 34811819      --------------------------------------------------------------------------------
gi 30316395      --------------------------------------------------------------------------------
gi 32449679      --------------------------------------------------------------------------------
gi 40316839      --------------------------------------------------------------------------------
gi 24642513      --------------------------------------------------------------------------------
gi 2493011   872 eaelvlqqrkslermvdeeamartslrnslssvpraslslqavrkslsmknsrtrdpekqidsidqfletvkksdqeigs 951
gi 56474175      --------------------------------------------------------------------------------
gi 27802717      --------------------------------------------------------------------------------
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 30316390  567 ----------------------------------------------------------------kymeETLCHLEYFAt- 581
gi 31340488  943 ---rekmgvvrprastsiletrrrpavgrhslaggerlmedkkylskqeeaegsiyeslnhndaklfeNTFEHVHAFAt- 1018
gi 34811819  577 ------------------------------------------------------------------apDVQGHIENVEip 590
gi 30316395  609 -----------------------------------------------------------------eieKTRIHVDEFAl- 622
gi 32449679  576 -----------------------------------------------------------------qveRIKVHVEKNAl- 589
gi 40316839  580 -----------------------------------------------------------------eieLTKVHVERNAm- 593
gi 24642513  573 -----------------------------------------------------------------lveQTDAQITKYAq- 586
gi 2493011   952 vvnksrkslhkqqiekygprisidgthfpnnnvpidtrkeglqhdydteilehigsdelilneeyvieRTLQAIDEFSt- 1030
gi 56474175  595 -----------------------------------------------------------------nfeATNKQLQDFSv- 608
gi 27802717  547 --------------------------------------------------------------------RPEEVDRIRLq- 557
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 30316390  582 ------eGLRTLCVAYADLSENEYeewlkvyqeasTILKDRAQRLEECYEIIEKNLLLLGATAIEDRLQAgVPETIATLL 655
gi 31340488 1019 ------dGLRTLMYAHRFIDESEYqswklvndaalNSLSNRQQLLDEAADLIEKDLEFAGATAIEDKLQVgVPESINSLF 1092
gi 34811819  591 ltemsssGLRTLLVCAKDITRRQFdpwfekfveagKSLHNRSSNIDKVCLEMEQDMRLVGATAIEDKLQDeVPETLSFFL 670
gi 30316395  623 ------kGLRTLCIAYRKFTSKEYeeidkrifearTALQQREEKLAAVFQFIEKDLILLGATAVEDRLQDkVRETIEALR 696
gi 32449679  590 ------dGYRTLCVAFKEISQELYdninkqleeakLALQDREERLAKVFDDIEVDMHLLGATAVEDRLQEqASETIEALH 663
gi 40316839  594 ------dGYRTLCVAFKEIAPDDYerinrqlieakMALQDREEKMEKVFDDIETNMNLIGATAVEDKLQDqAAETIEALH 667
gi 24642513  587 ------nGLRTMAVGRRMLTDDELfhfeelyrkanTQLSNRNELIASCYETVENELDLLGATALEDALQEhVGETLEALQ 660
gi 2493011  1031 ------eGLRTLVYAYKWIDIGQYenwnkryhqakTSLTDRKIKVDEAGAEIEDGLNLLGVTAIEDKLQDgVSEAIEKIR 1104
gi 56474175  609 ------vGLRTLLVTKKEISQEQYnewrkrydeadSSVAGHDENVALIQDEMEVDLKLIGATAIEDKLQDgVPETIEFLI 682
gi 27802717  558 ------dGYRTLCVAYKQLSAEEYaladtglrearLALQDREEKLMAMYNQVETGMSLIGATAVEDRLEE-AAETMEALQ 630
                       1050      1060      1070      1080      1090      1100      1110      1120
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 30316390  656 KAEIKIWVLTGDKQETAINIGYSCRLVSQNMAlillkedsldatraai-----------------------tqhctdlgn 712
gi 31340488 1093 RAGIKFWMLTGDKKETAINIGHSCGVIKEYSTvvvmgsldgvegsdetvsggqrlsldrpptndpaslmihqliscmnai 1172
gi 34811819  671 SAGVIIWMLTGDKRETAVTIAATSTLCDPRNDfidhidighlnssdpkaierv-------------grdlevveqhialk 737
gi 30316395  697 MAGIKVWVLTGDKHETAVSVSLSCGHFHRTMNilelinqksdsecae------------------------qlrqlarri 752
gi 32449679  664 AAGMKVWVLTGDKLETAKSTCYACRLFQSNTEllelttkdleeyerkedrlqellle-----yhrklvqeapkmkgganr 738
gi 40316839  668 AAGLKVWVLTGDKMETAKSTCYACRLFQTNTEllelttktieeserkedrlhellie-----yrkkllhefpkstrsfkk 742
gi 24642513  661 AAGLKIWVLTGDKVETAYNIGLACRHIPRGSKqhfiinttepae------------------------------llarld 710
gi 2493011  1105 RAGIKMWMLTGDKRETAINIGYSCMLIKDYSTvviltttdeniisk--------------------------mnavsqev 1158
gi 56474175  683 RGGIKVWMITGDKVETAINIGLSCNLLTKETFicklrnapdeienkeefttkkl-----------vemdeeidkeierck 751
gi 27802717  631 GAGMKIWVLTGDKMETAKSTCYACRLFQRGTElleltvrtledgrskredrllellrd---yhrravqdappvktgvvtr 707
                       1130      1140      1150      1160      1170      1180      1190      1200
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 30316390  713 llgkenDVALIIDGHTLKYalsfev-------rrsflDLALSCKAVICCRVSPLQKSEIVDVVKkrv-kaiTLAIGDGAN 784
gi 31340488 1173 hsnslaHLVIVIDGSTLADiendpe------lfllfiNTAVEADSVICCRSSPMQKALMVQKVRntlekavTLAIGDGAN 1246
gi 34811819  738 gthkerRCTLVIDGPALNIamehy--------fdqflRLSHQVNSAVCCRLTPIQKATVVRMFQkst-gktALAIGDGAN 808
gi 30316395  753 tedhviQHGLVVDGTSLSLalreh--------eklfmEVCRNCSAVLCCRMAPLQKAKVIRLIKispekpiTLAVGDGAN 824
gi 32449679  739 nwtgnqDHGLIIDGATLSLilnsncss--shykniflQICQKCSAVLCCRMAPLQKAQIVKMVKntkgspiTLSVGDGAN 816
gi 40316839  743 awtehqEYGLIIDGSTLSLilnssqdsssnnyksiflQICMKCTAVLCCRMAPLQKAQIVRMVKnlkgspiTLSIGDGAN 822
gi 24642513  711 migddePEVLIVDGTTITAlleht--------prqfaDLALRCRAVLCCRLSPLQKSEIVTLIKrrk-kyiTAAIGDGAN 781
gi 2493011  1159 dsgniaHCVVVIDGATMAMfegnpt------ymsvfvELCTKTDSVICCRASPSQKALMVSNIRntdpnlvTLAIGDGAN 1232
gi 56474175  752 segkayNIGCVFEAGALQVvmaha--------kdlfrQVILKASVVICSRVTPKQKAMIAKTVKeat-kkvVLTIGDGAN 822
gi 27802717  708 swsanqEYGFIIDGATLSLvmnpprdadaslyrglflQICQNCTAVLCCRMAPLQKAQIVKMVKnckgspiTLSIGDGAN 787
                       1210      1220      1230      1240      1250      1260      1270      1280
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 30316390  785 DVGMIQTAHVGVGISGNEGMQATNNSDYAIAQFSYLEKLLLVHGAWSYNRVTKCILYCFYKNVVLYIIELWFAFVNGFSG 864
gi 31340488 1247 DIAMIQEAHVGIGIAGREGLQAARSSDFSIGRFKFLIKLLFCHGRWSYVRLSKYILGTFYKEQFFFLMQAIMQPFVGYTG 1326
gi 34811819  809 DVSMIREGRVGVGIIGLEGAHAALAADYAIPRFKHLRRLCAVHGRYSLFRNASCILVSFHKNITVSVVQFIFAFYVGFSG 888
gi 30316395  825 DVSMIQEAHVGIGIMGKEGRQAARNSDYAIARFKFLSKLLFVHGHFYYIRIATLVQYFFYKNVCFITPQFLYQFYCLFSQ 904
gi 32449679  817 DVSMILEAHVGIGIKGKEGRQASRSSDYAVPKFKHLRKLLLVHGHLYYVRIAHLVQYFFYKNLCFILPQFLYQFFCGFSQ 896
gi 40316839  823 DVSMILESHVGIGIKGKEGRQAARNSDYSVPKFKHLKKLLLAHGHLYYVRIAHLVQYFFYKNLCFILPQFLYQFFCGFSQ 902
gi 24642513  782 DVSMIQEAHIGIGITGREGKQAARCADFSIARFEMLRRLFLVHGHYNSQRLAFLVLFYCYKNIIITGCMALYQVYDLYSA 861
gi 2493011  1233 DIAMIQSADIGVGIAGKEGLQASRVSDYSIGQFRFLLKLLFVHGRYNYIRTSKFMLCTFYKEITFYFTQLIYQRYTMFSG 1312
gi 56474175  823 DVAMINEGDIGVGLFGKEGTQAARASDYALRKFRHLAKLIMFHGRNSLLRNVTLIKMCFYKNASFFLILFWYSFFNGQSG 902
gi 27802717  788 DVSMILEAHVGIGIKGKEGRQAVRNSDYAIPKLKHLKKLLLAHGHLYYVRIAHLVQYFFYKNLCFILPQFLYQFFCGYSQ 867
                       1290      1300      1310      1320      1330      1340      1350
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
Feature 1                                                                                   
gi 30316390  865 QILFERWCIGLYNVIFTALPPFTLGIFERSCtqESMLRFPQLYKITQNGEgfnTKVFWGHCINALVHSLILFWFP 939
gi 31340488 1327 QSLYESWGLTCFNTLFSSLCVIGLGIFEKDLsaSTVIAVPELYQKGINNEafnWRVYFGWCSIAFIQAFLVFYVT 1401
gi 34811819  889 LTLFDGWMLTFYNVLLTSIPPFFMGIFDKDLpeDALLERPKLYTPLSHGEyfnLATLLRWFVESLTTAVILFYAA 963
gi 30316395  905 QTLYDSVYLTLYNICFTSLPILIYSLLEQHVdpHVLQNKPTLYRDISKNRllsIKTFLYWTILGFSHAFIFFFGS 979
gi 32449679  897 QPLYDAAYLTMYNICFTSMPILAYSLLEQHIniEILSTNPKLYMRISDNAmlqWGPFLYWTLLGAFEGLVFFFGV 971
gi 40316839  903 QPLYDAAYLTMYNICFTSLPILAYSLLEQHIniDTLTSDPRLYMKISGNAmlqLGPFLYWTFLAAFEGTVFFFGT 977
gi 24642513  862 TNVYNSIYLWLFDIVYISFSFTVLAICDKDYseETLLSHPELYKPLAHNRqasMGVFSLWILNGFVQCFIIFFFT 936
gi 2493011  1313 SSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLkpMTLLTVPELYSYGRLSQgfnWLIFMEWVILATTNSLIITFLN 1387
gi 56474175  903 MSMYDDYTMTFFNIFITSLPPVFIACLDKDLsyQVIKDNPEVHRGILRGSrmsLASFLDWLGQGIWQSLLLTFVF 977
gi 27802717  868 QPLYDAAYLTMYNICFTSMPILAYSLLEQHIaiEILLDNATLYREIAKNAmlrWRPFLYWTVLGIFQGLLFFFGV 942

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap