Conserved Protein Domain Family
P-type_ATPase_Ca_PMCA-like

?
cd02081: P-type_ATPase_Ca_PMCA-like 
animal plasma membrane Ca2(+)-ATPases (PMCA), similar to human ATP2B1-4/PMCA1-4, and related Ca2(+)-ATPases including Saccharomyces cerevisiae vacuolar PMC1
Animal PMCAs function to export Ca(2+) from cells and play a role in regulating Ca(2+) signals following stimulus induction and in preventing calcium toxicity. Many PMCA pump variants exist due to alternative splicing of transcripts. PMCAs are regulated by the binding of calmodulin or by kinase-mediated phosphorylation. Saccharomyces cerevisiae vacuolar transporter Pmc1p facilitates the accumulation of Ca2+ into vacuoles. Pmc1p is not regulated by direct calmodulin binding but responds to the calmodulin/calcineurin-signaling pathway and is controlled by the transcription factor complex Tcn1p/Crz1p. Similarly, the expression of the gene for Dictyostelium discoideum Ca(2+)-ATPase PAT1, patA, is under the control of a calcineurin-dependent transcription factor. Plant vacuolar Ca(2+)-ATPases, are regulated by direct-calmodulin binding. Plant Ca(2+)-ATPases are present at various cellular locations including the plasma membrane, endoplasmic reticulum, chloroplast and vacuole. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.
Statistics
?
PSSM-Id: 319776
View PSSM: cd02081
Aligned: 32 rows
Threshold Bit Score: 914.282
Threshold Setting Gi: 23465604
Created: 15-Dec-2004
Updated: 18-Aug-2016
Structure
?
Aligned Rows:
 
Feature 1: P-type ATPase signature motif, 7 residue positions
Conserved feature residue pattern:D K [TS] G T [LIVM] [TS]Click to see conserved feature residue pattern help
Evidence:
  • Comment:a characteristic P-type ATPase conserved sequence motif: DK[TS]GT[LIVM][TS], in which D is the reversibly phosphorylated Asp

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 14286105    73 LEKRRQVFGHNvippkkpktflELVWEALQDVTLIILEIAAIISLVLsfyrpageenelcgqvattpedeneaqaGWIEG 152
gi 40644468   155 IQRRKDAYGSNtypkkkpkgllHFVWEAMQDTTLIILIVAAIVSLGAemwsq-------------------gvktGWYDG 215
gi 12229659   133 VSRRRDLFGSNtyhkpppkgllFFVYEAFKDLTILILLVCAIFSLGFgikeh-------------------gikeGWYEG 193
gi 74624462   205 DSDRVKYYGKNvlpehdskgliRLMLEAFKDKVLILLSIAAVVSLALglyqtfgqpptl-----dpitgkpeprvEWVEG 279
gi 3392885     70 YSKRQEQFGKNrtpdavivpfwKIWFEALQDKTLIILIIAAIVSLILafavpnsvdkcl----akeneedkelntDWIEG 145
gi 728904      84 KTNRYKNYGDNslperipksflQLVWAAFNDKTMQLLTVAAVVSFVLglyelwmqppq------ydpegnkikqvDWIEG 157
gi 116059662   66 AAERISTYGKNefeypppksflELCQDALGDLTVRILIMASVVSLGVgagmks-----------------hreeyGYLEG 128
gi 27461073    67 VENRRAVYGRNelpeeapltlwKIFKAAWSDRMIILLTLAACVSLILgltvpepg------------hekvdyktGWIEG 134
gi 34397008   170 VLHSRATHGSNeltprereslwSKFFEKFKDPIIIILLVAMVLSFAVacyhyft---------------ggegvsVFLEP 234
gi 166203130   68 EENRVLKYSKNilpdpphqplwSIVLDALSDHILILLIVAAVVSIVLgsidyt----------------sdhpetGWIDG 131
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 14286105   153 AAILFSVIIVVLVTAFNDwskekqFRGLQCrieqeqkFSIIRNGQLIQlpvaEIVVGDIAQVkyGDLLPADGILIqgndL 232
gi 40644468   216 TAILVAVLLVIVTTAGSDykqslqFRNLNEeke-nihLDVVRGGERKQisiwDIVVGDVIPLsiGGQVPADGVLIeghsL 294
gi 12229659   194 GSIFVAVFLVIVVSALSNfrqerqFDKLSKisn-nikVEVLRDSRRQHisifDVVVGDVVFLkiGDQIPADGLFLeghsL 272
gi 74624462   280 VAIMAAIVIVVTVGGVNDwqkelqFKKLNAkvs-nfdVQVLRDGAVHStsvfDLVVGDVLFVeaGDVVPVDGVLIesnnL 358
gi 3392885    146 VAILIAVLAVSLGGSASDyskqkkFLALSQeek-dvgIKVIRNGENQKtsifNLSVGDIVNLdvGDIIPADGIYIhgndL 224
gi 728904     158 VAIMIAVFVVVLVSAANDyqkelqFAKLNKkke-nrkIIVIRNDQEILisihHVLVGDVISLqtGDVVPADCVMIsg-kC 235
gi 116059662  129 IAIVLVVFVVVFLQAGIDyakemkFRQLNSikd-nyqVKVIRDGEVVAvtagEVVVGDLVELvaGDKVPADALFVegskF 207
gi 27461073   135 TAILMAVIAVTSASSIQDyrkelkFRALVEens-aqpISVIRDGHKVTvdvtEIVVGDLVSLspGLVIPVDGLYVrglsV 213
gi 34397008   235 TGVLLAVVLATGVAFFFEmksekeFEILNQvne-dilYKVYRNGMICRvlkkEIVVGDLVVLetGEQIPADGRLIeaisL 313
gi 166203130  132 VAILVAVILVVGITSLNDfknqarFRELNDksn-dkeVKGIRGGEQCQisifDVKVGDIISLdtGDIICADGVFIeghaL 210
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 14286105   233 KIDESsLTGESd---HVKKsld----------------------------------kdpMLLSGTHVm-eGSGRMVVTAV 274
gi 40644468   295 SIDEStMTGESe---PVKKdsk-----------------------------------rpYLLSGCKVl-dGQGLMLVTGV 335
gi 12229659   273 QVDESsMTGESdhleVDHKdn-------------------------------------pFLFSGTKIv-dGFAQMLVVSV 314
gi 74624462   359 VLDESaMTGETd---NIKKvdantaierts------------------pdveyrknadpYLISGTTIl-eGNGKLLVTAV 416
gi 3392885    225 RVDQAsMTGESv---AVRKtse-----------------------------------nfSMMSGTKVm-dGNGKMLVVAV 265
gi 728904     236 EADESsITGESn---TIQKfpvdnslrdfkkfnsidshnhskpldigdvnedgnkiadcMLISGSRIl-sGLGRGVITSV 311
gi 116059662  208 KANEAaMTGEPi---DIAKtre----------------------------------kdpWVLSGTSIs-eGSGKVVIIAV 249
gi 27461073   214 VVDESsVTGEN----DLKKkga----------------------------------ehpILLSGTVVstaEDAYILACAV 255
gi 34397008   314 QIDESsLTGEP----VVNKttdrqdfd------------------------aeatypsdYICRGTTIl-dGHCTFRVEKV 364
gi 166203130  211 KCDESsITGESd---PIKKgqpqd-------------------------------nmdpFLISGSMVi-eGFGTMLVTAV 255
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 14286105   275 GvnsqtGIILTLLGVNeddegekkkkgkkqgvpenrnkaktqdgvaleiqplnsqegidneekdkkavkvpkkekSVLQG 354
gi 40644468   336 GvntewGQVMASVSEDng-------------------------------------------------------eeTPLQV 360
gi 12229659   315 GmsttwGQTMSSINQDss-------------------------------------------------------erTPLQV 339
gi 74624462   417 GvnsfnGRTTMAMRTEgq--------------------------------------------------------aTPLQL 440
gi 3392885    266 GpnslwGKTMEAVNQNks-------------------------------------------------------apTPLQE 290
gi 728904     312 GinsvyGQTMTSLNAEpe--------------------------------------------------------sTPLQL 335
gi 116059662  250 GsrsqwGVILKTLIVEps--------------------------------------------------------dTPLQE 273
gi 27461073   256 GessfgGKLLMESRLDgep------------------------------------------------------raTPLQE 281
gi 34397008   365 GdateyGRVFEGARPDns-------------------------------------------------------vqTPLNR 389
gi 166203130  256 GvnsfnGKTMMGLRVAse--------------------------------------------------------dTPLQM 279
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 14286105   355 KLTRLAVQIGKAGLLMSALTVFIlilyfvidnfvinrrpwl----------------------------pectpiyiqyf 406
gi 40644468   361 RLNGVATFIGKVGLTVAGVVFIIliirfftidfkqpenr--------------------------------kssnilthi 408
gi 12229659   340 RLDTLTSTIGKIGLTVAALVLVVllvryftgntekegkreyn-------------------------gsktpvdtvvnsv 394
gi 74624462   441 RLSRVADAIAKLGGAASALLFIVllieflvrlksndss----------------------------------sknkgqef 486
gi 3392885    291 NLDELAVKIGYLGMGCGALVFIVltiyyivsqfthkdvlkadeekgiiagclecnvtredvmwneycekysfdwssltgl 370
gi 728904     336 HLSQLADNISVYGCVSAIILFLVlftrylfyiipedgrfh-----------------------------dldpaqkgskf 386
gi 116059662  274 RLERLVLLIGNFGIGAAVLTFLAsmirwivegaqgk-------------------------------------gwdgtev 316
gi 27461073   282 RSQNLVSFIARVAIISAVLFFIVlciieieriatnkq------------------------------------qfypkkf 325
gi 34397008   390 QLDHLAGLITNVSYSIAALVLIGsiimyaanggffpfd----------------------------------wayalsff 435
gi 166203130  280 KLSVLASRIGYFGMGAAILMLLIaipkyfiqrkvhdie---------------------------------itredaqpi 326
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                   #######               
gi 14286105   407 vkffiiGITVLVVAVPEGLPLAVTISLAYSVKKMmkdnNLVRHLDACETMGNAtAICSDKTGTLTMNRMTVVQAYIggih 486
gi 40644468   409 veifsiAVVIVVVAVPEGLPLAVTLTLAYSMRKMmadkSLVRHLSACETMGSAtTICSDKTGTLTTNKMTAVRAWVanae 488
gi 12229659   395 vrivaaAVTIVVVAIPEGLPLAVTLTLAYSMKRMmsdqAMVRKLSACETMGSAtVICTDKTGTLTLNEMKVTKFWLgqes 474
gi 74624462   487 lqilivSVTLLVVAVPEGLPLAVTLALAFATNRMqkdnNLVRHLQACETMGTAtNICSDKTGTLTQNRMTVVAGGFgtdv 566
gi 3392885    371 idyfiiGVTIIVVAVPEGLPLAVTISLAYSMKQMfkdnNLVRHLKVCETMSNCtNICSDKTGTLTENRMTVVNGWFggik 450
gi 728904     387 mnifitSITVIVVAVPEGLPLAVTLALAFATTRMtkdgNLVRVLRSCETMGSAtAVCSDKTGTLTENVMTVVRGFPgnsk 466
gi 116059662  317 lnflinAVTIVVVAIPEGLPLAITLGLAFAMRKMmsdqNLVRRLEACETMGSAtQLNADKTGTLTQNRMTVTSCWIdgks 396
gi 27461073   326 lnflllCVTIVVIAVPEGLPLVVTIALAYSQSQMqkdnNQVRRLCACETMGNAtQICSDKTGTLTQNRMTVVQGYIgmrr 405
gi 34397008   436 lnkimiAVTVIVVAVPEGLPMSVTLSLAYSMRSMmktnNLVRKMHACETMGAAtVICTDKTGTLTQNRMAVADTYFepeh 515
gi 166203130  327 vqlvisAITIVVVAVPEGLPLAVTMALAYGMMKMfkenNLVRNLASCETMGSAtTICSDKTGTLTQNVMSVVTGTIcgvf 406
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 14286105   487 yrqipspdvflpkvldlivng----------------------------------------------------------- 507
gi 40644468   489 nnaasadgvpeslrqtlih------------------------------------------------------------- 507
gi 12229659   475 ihedstkmispdvldllyq------------------------------------------------------------- 493
gi 74624462   567 lffdhndetptnvdqgsdsskfedagasafaf-------------------------------------krlspelrdlt 609
gi 3392885    451 metrdqkfqflknmkklin------------------------------------------------------------- 469
gi 728904     467 fddskslpvseqrklnskkvfeencssslrndllanivlnstafenrdykkndkntngsknmsknlsfldkcksrlsffk 546
gi 116059662  397 yddmpptvgkdfaerlce-------------------------------------------------------------- 414
gi 27461073   406 frvsnpgdpsstvnlegvssdaqsllmlg-------------------------------------------lalnssse 442
gi 34397008   516 eadssllaeamaa------------------------------------------------------------------- 528
gi 166203130  407 ptldgiaqkipkhvqsilt------------------------------------------------------------- 425
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 14286105   508 isinsaytskilppekegglprqvGNKTECALLgfvtdlkqdyq----------avrnevpeekLYKVYTFNSvRKSMST 577
gi 40644468   508 --siclnstgtvappkegtepvvsGSPTESACLgwglklgme-------------fkklrhattILHVETFNStKKRAGV 572
gi 12229659   494 --gtglnttgsvcvsdsgstpefsGSPTEKALLswtvlnlgmd------------mesvkqkheVLRVETFSSaKKRSGV 559
gi 74624462   610 lysiavnstcrqlfednsdtprfiGSKTETALLdmsvkelglt-----------nvdsmrssvdIKQFFSFSSdRKASGA 678
gi 3392885    470 -mnisinsspsttlisengqinviGNKTEGALLmyvkergvdy-----------leirkrnennIYQMFAFSSaKKRMNT 537
gi 728904     547 kgnreddedqlfknvnkgrqepfiGSKTETALLslarlslglqpgelq--ylrdqpmekfniekVVQTIPFESsRKWAGL 624
gi 116059662  415 ---smavnsdanlhkkengaiehlGSKTECALLqlveqlqppsgdd------kyryveirearpVAQLYHFTSaRKRMST 485
gi 27461073   443 kellpgnvgaesdllsrwtwrtdkGNKTDQAILdfvdrvlisvpgscndkelphqklrmtncsrGFAIFPFTSeRKFMTA 522
gi 34397008   529 -------nstayldcsdeksirplGNPTEGALLlwlrergin-------------yltvreacpLLLQLTFSTeRKYMAT 588
gi 166203130  426 --dgmainsnayegvsskgklefiGSKTECALLnfgklfgcd-------------ynevrkrleVVELYPFSSaRKRMSV 490
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 14286105   578 VIRnpn-----ggFRMYSKGASEIILRKCnrildrkgeavpfknkdrdDMVRTVIEPMAc----dGLRTICIAYRDfddt 648
gi 40644468   573 VFKndq-----gvVEAHWKGAAEIILSLCskfvnehge-vqtmtpeknEELKRVIEGMAa----qSLRCIAFAYRPidgs 642
gi 12229659   560 LVRrks----dntVHVHWKGAAEMVLAMCshyytstgs-vdlmdstakSRIQAIIQGMAa----sSLRCIAFAHKIasnd 630
gi 74624462   679 IFEyk------dkYYFVVKGMPERVLQQStsvitngsldevedmhshaDYFKEMITGYAk----rSLRTLGLCYRVfdsw 748
gi 3392885    538 LVWidk----pntIRMFTKGAPEMILEKCqyymngq-----geikeitEEVRQELEECQvewaskGYRTLSLSYKDitpa 608
gi 728904     625 VVKykegknkkpfYRFFIKGAAEIVSKNCsykrnsddt-leeinednkKETDDEIKNLAs----dALRAISVAHKDfcec 699
gi 116059662  486 AIAng------sgTRLHVKGASEIVVKLCtkimsadgk-vsglsspvlKQAEAAIEAFAr----kGLRTLCIAYNDlska 554
gi 27461073   523 VVAgad-----gvVMQYVKGGSDRVLGMCnrylssegr-eeplteevtEMITEQIRSIAg----dANRTIGVAYGRigtd 592
gi 34397008   589 VVRsas----lgkPVLWVKGAPEIVLGFCslpd-----------eekfDSYTRKLAEYQg----kAMRTIGFAYKElssd 649
gi 166203130  491 LVKhd------qnLRLFTKGASEIILGQCgsyldeagn--irpiseakAYFEEQINNFAs----dALRTIGLAYRDfqyg 558
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 14286105   649 epsw---------------dneneiltELTCIAVVGIEDPVRPEVPDAIAKCKQAGITVRMVTGDNiNTARAIATKCGIL 713
gi 40644468   643 dvpsnee----------ssyewnqpdeDLIFMAICGIKDPCRPGVRDAVERCQKAGVKVRMVTGDNkFTAKAIAQECGIL 712
gi 12229659   631 s---------------------vleedGLTLMGIVGLKDPCRPGVSKAVETCKLAGVTIKMITGDNvFTAKAIAFECGIL 689
gi 74624462   749 ppkdiptnde----dssnplkwedaftDMTFLGFFGIMDPIRPDVPLAVKVCQGAGVTVRMVTGDNiVTAKAIASQCGIY 824
gi 3392885    609 nrnnle------------ekyevaneeGSIIISLFGIEDPVRREVPGAVATCQRAGIIVRMVRGDNiATARSIAKQCNII 676
gi 728904     700 dswppeqlrdkdspniaaldllfnsqkGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNiLTAKAIARNCAIL 779
gi 116059662  555 psal----------------gdnppesDLILLGIMGIKDPIRPETAEAVRLLRGAGVTVRMVTGDNaITAEAIAREAGIL 618
gi 27461073   593 gav-----------------peeepegPFVWLALLGIQDPLRPEVVDAVRMCQRAGVTVRMCTGDNlDTAVAISRQCGIY 655
gi 34397008   650 keqvf--------------angrlhvhDLRFMGIVGIADPIRSDVPEAISDCMKAGIQVKIVTGDTpGTAREIGRQIGLW 715
gi 166203130  559 ecd-----------------fkeppenNLVFIGIVGIKDPLRPEVPEAVEICKRAGIVVRMVTGDNlVTAQNIARNCGIL 621
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 14286105   714 tpgd---dflcLEGKEFNRLIRNekgeveqe-kldkiwpKLRVLARSSPTDKHTLVKGIIdstvgehrqVVAVTGDGTND 789
gi 40644468   713 teg-----glvVEGPDFRTWDEAridr---------dieKLVVMARSSPTDKLKLVKALKqr-----snVVAVTGDGTND 773
gi 12229659   690 dhndkdeedavVEGVQFRNYTDEermq---------kvdKIRVMARSSPSDKLLMVKCLRlk-----ghVVAVTGDGTND 755
gi 74624462   825 ted-----gisMEGPEFRSLSDEkrle---------ilpKLDVLARSSPLDKQLLIEGLQkl-----gnVVAVTGDGTND 885
gi 3392885    677 sren----diaIEGPKFAELTDEeiie---------kleNLRVIARCSPQDKERLVKLLIsq-----geVVAVTGDGTND 738
gi 728904     780 stdisseaysaMEGTEFRKLTKNerir---------ilpNLRVLARSSPEDKRLLVETLKgm-----gdVVAVTGDGTND 845
gi 116059662  619 eegd---dglvLEGPDFRKMSDAekes---------iamRIRVLARSSPSDKLVLCNLQRkl-----geVVAVTGDGTND 681
gi 27461073   656 nrlr---gdlaLTGKDFRNLVYDtygdeanmekfwpvldRMMVMGRSQPLDKQLLVLMLMlr-----geVVAVKGDGTND 727
gi 34397008   716 desct--ernmITGSDFAALTDEelrp---------rigELRIMSRARPMDKERLVRLLQea-----heVVAVTGDGTND 779
gi 166203130  622 teg-----glcMEGPKFRELSQSemda---------ilpKLQVLARSSPTDKQLLVGRLKdl-----geVVAVTGDGTND 682
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 14286105   790 GPALKKADVGFAMGiaGTDVAKEASDIILTDDNFTSIvKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACItq--- 866
gi 40644468   774 APALHEADIGLSMGiaGTEVAKESSDIIILDDNFTSVvKVVRWGRSVYANIQKFIQFQLTVNVTALTINFVASIStg--- 850
gi 12229659   756 APALKEADIGLSMGiqGTEVAKESSDIVILDDNFASVaTVLKWGRCVYNNIQKFIQFQLTVNVAALVINFIAAISag--- 832
gi 74624462   886 APALKKANVGFSMGksGTEVAKEASDIILMDDNFSSIvKAIAWGRTVNDAVKKFLQFQITVNITAVFLTIISAVAstd-- 963
gi 3392885    739 VPALKAADVGLAMGirGTDVAKQASDIVILDDNFQSIvNSVNGERCVYDNIRKFLQFQLTVNISALALCVIGSIFig--- 815
gi 728904     846 APALKLADVGFSMGisGTEVAREASDIILMTDDFSAIvNAIKWGRCVSVSIKKFIQFQLIVNITAVILTFVSSVAssd-- 923
gi 116059662  682 APALKDADVGFALGiaGTEIAKEACDIVILDDNIKSMaKAVLWGRNVYQSIRKFLQFQLVVNVVAVSLNLIAAIAgik-- 759
gi 27461073   728 APALRLANVGFVMRs-GHGYSGEVRCIVLLDDNFRSVqRAVVWGRTVNDNIRKFLQLQFTVNLVCFSLTVVGTLVreg-- 804
gi 34397008   780 APALNRAQVGLSMGd-GTAVAKEASDITILDNSFSSIaKAVMWGRSLYRNIRRFILFQMTINVVACIIVLIGAFVgt--- 855
gi 166203130  683 GPALKLANVGFSMGisGTEVAIAASDVVLLDDNFASIvRAVLWGRNIYDAICKFLQFQLTVNVVAVTVAFIGTLTsdvve 762
                         970       980       990      1000      1010      1020      1030
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
Feature 1                                                                                
gi 14286105   867 ---------------------dsPLKAVQMLWVNLIMDTFASLALATEPPTesllkrrPYGRNKPLISRTM 916
gi 40644468   851 ---------------------evPLTAVQLLWVNLIMDTLGALALATEPPTddlmdrkPVGRTEPLISNIM 900
gi 12229659   833 ---------------------evPLTAVQLLWVNLIMDTLGALALATERPTnellkrkPVGRTEALITNVM 882
gi 74624462   964 --------------------qssVLTAVQLLWVNLIMDTLAALALATDPPTpevlkrkPEKPGASLFTFDM 1014
gi 3392885    816 ---------------------esPLNALQMLWVNLIMDTMAALALGTEKTNrfiidrkPFGRFDSLISNIM 865
gi 728904     924 --------------------etsVLTAVQLLWINLIMDTLAALALATDKPDpnimdrkPRGRSTSLISVST 974
gi 116059662  760 ---------------------elPLAAVPLLWVNMIMDSMGALALATEPPSahlmkkkPFGRSAPLINKPM 809
gi 27461073   805 --------------------kssPLTTVQLLWVNLLMDTLAAPALATEQPTedclnrgPSSPRAPLVSRRM 855
gi 34397008   856 ---------------------esPLTVTQMLWVNLIMDTFAALSLASLPPDkgvmkeqPRRQDDAIINPLM 905
gi 166203130  763 dkdnssssgsadkvteeeprqgsPLTAVQLLWVNLIMDTLAALALATEPPTpellerpPNGKNAPLITRSM 833

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap