1K4V,1LZI


Conserved Protein Domain Family
Glyco_transf_6

?
cd02515: Glyco_transf_6 
Click on image for an interactive view with Cn3D
Glycosyltransferase family 6 comprises enzymes responsible for the production of the human ABO blood group antigens.
Glycosyltransferase family 6, GT_6, comprises enzymes with three known activities: alpha-1,3-galactosyltransferase, alpha-1,3 N-acetylgalactosaminyltransferase, and alpha-galactosyltransferase. UDP-galactose:beta-galactosyl alpha-1,3-galactosyltransferase (alpha3GT) catalyzes the transfer of galactose from UDP-alpha-d-galactose into an alpha-1,3 linkage with beta-galactosyl groups in glycoconjugates. The enzyme exists in most mammalian species but is absent from humans, apes, and old world monkeys as a result of the mutational inactivation of the gene. The alpha-1,3 N-acetylgalactosaminyltransferase and alpha-galactosyltransferase are responsible for the production of the human ABO blood group antigens. A N-acetylgalactosaminyltransferases use a UDP-GalNAc donor to convert the H-antigen acceptor to the A antigen, whereas a galactosyltransferase uses a UDP-galactose donor to convert the H-antigen acceptor to the B antigen. Alpha-1,3 N-acetylgalactosaminyltransferase and alpha-galactosyltransferase differ only in the identity of four critical amino acid residues.
Statistics
?
PSSM-Id: 133008
View PSSM: cd02515
Aligned: 11 rows
Threshold Bit Score: 413.261
Threshold Setting Gi: 47215191
Created: 10-Apr-2003
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
substrateactive site
Conserved site includes 12 residues -Click on image for an interactive view with Cn3D
Feature 1:substrate binding site
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                ###  #                                  
1K4V_A        15 RPEVVTMTKWKAPVVWEGTYNraVLDNYYakQKITVGLTVFAVGRYIEhYLEEFLTSANKHFMVGHPVIFYIMVD--DVS 92
1LZI_A        19 RKDVLVVTPWLAPIVWEGTFNidILNEQFrlQNTTIGLTVFAIKKYVA-FLKLFLETAEKHFMVGHRVHYYVFTD--QPA 95
gi 30354607   43 RTDVVTLTPWLAPVVWTGTFDskMIDSIYkhQNITVATTVFALGKYTR-FLKDFLESAEEHYFDGFRVHYYLFTD--QPE 119
gi 67464687   76 PTQLLTLTPWLAPIVSEGTFNpeLLQHIYqpLNLTIGVTVFAVGKYTH-FIQSFLESAEEFFMRGYRVHYYIFTD--NPA 152
gi 71897301   72 RQDVLTVTPWLAPIVWEGTFSpeILDSAYmpLNLTIGVTAFAVGKYTR-FVSRFLKSAEMHFMKGYRVNYYIFTD--NPK 148
gi 55778210   64 RTDVLSVSPWLAPIVWEGNFNidILNEQFhqRDVRIGLTVFAIKKYIR-FLKTLIETAEKFFMVGHQVNYYVFTDlvRNV 142
gi 47215191    3 AAQMPLETSWGAPLVWGDSRKsaKRRAKLgeLEIRTGLAALVVGTYAK-FARRFLSSAEIYFLPDQTVTYYILTDn-PRT 80
gi 47229830   22 RGDVQTCTPWKAPIIWEGMFDpeLYDRTHqkEGTSVALTVFAVGRYLEaYLEAFLQSAERHFMVGLPVIYYVFTD--KPD 99
gi 119627868  80 RPEVLTCTPWGAPIIWDGSFDpdVAKQEArqQNLTIGLTIFAVGRYLEkYLERFLETAEQHFMAGQSVMYYVFTE--LPG 157
gi 73967586   49 RPDVVTTTDWLAPVIWEGTFNrrVLEEYYrgQDLTIGLAVLATGRIADqYLELFIQSANKHFMTGYRVIFYIMVD--AMC 126
gi 84875495   45 RLDVITTTDWLAPIIWEGTFDrkVLETYFrkQNITVGLAVFAVGSLTDkYLDPFLQSASKFFMPGYRVIFYIMVD--KYL 122
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                  #   #                      ###                        
1K4V_A        93 RMPLIELGPLRSFKVFKIKPeKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWY 172
1LZI_A        96 AVPRVTLGTGRQLSVLEVRAyKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFY 175
gi 30354607  120 AVPEVKMGENHRLTVRKVPSlDRWQDISMGRMEILEKLIADELMHEANYIFCLDVDTKFYGRWGSETLGNLVGVIHPWFF 199
gi 67464687  153 AVPGVPLGPHRLLSSIPIQGhSHWEETSMRRMETISQHIAKRAHREVDYLFCLDVDMVFRNPWGPETLGDLVAAIHPSYY 232
gi 71897301  149 MIPDVQLQPGRRFDVVHIKKySSWQEISVRRMEAINLHIAERSHREVDYLFCLDIDMVFHNAWGAETLGDMVAAIHPGYF 228
gi 55778210  143 TNFNITVGTGRRLVFLEVPSyKRWQDVSMRRMQMIRDASQQRFAYEVDYLVCIDVDMRFQDHVGVEILSDVFGTLHPAFF 222
gi 47215191   81 LEPPVKLGPGRKLTVIHIAElPGWSRLAYRRMSLLADAIRDLIGSEVEYVFCADVDQEFVAPVGTEILGDLVATLHPELY 160
gi 47229830  100 KIPHIELGPRREIKVVQVHRdSRWQDISMKRMKTIAETIESDIRHHCQYVFCLDVDQVFTGRFGPEALGESVGLLHAYYY 179
gi 119627868 158 AVPRVALGPGRRLPVERVAReRRWQDVSMARMRTLHAALGGLPGREAHFMFCMDVDQHFSGTFGPEALAESVAQLHSWHY 237
gi 73967586  127 RLPNLEPGPLQTFQVFTIRE-DSREDFHLMHMKNLASHILGHIQDEVDFLFSMTANRVFQNDFGVETLGTSVAQLHAWWY 205
gi 84875495  123 QLQEMEHNPLQSFQVLKIGKeRWWSNFDLMRMKILSEHIRDHIRYEVDFLFSMNINMVFQSEFGVETLSTSVAQLHPWWY 202
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1K4V_A       173 KADPNDFTYERRKESAAYIpfGEGDFYYHAAIFGGTPTQVLNITQECFKGILKDKKNDieaqWHDESHLNKYfl-lnKPT 251
1LZI_A       176 GSSREAFTYERRPQSQAYIpkDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGieavWHDESHLNKYll-rhKPT 254
gi 30354607  200 DYPRESFTYERRPESKAFIavGEGDYYYTAAAFGGTLEEIHRLTKTCREQLNADHENSieaiWHEESHLNKYfl-ynKPT 278
gi 67464687  233 AVPRQQFPYERRRVSTAFVadSEGDFYYGGAVFGGQVARVYEFTRGCHMAILADKANGimaaWREESHLNRHfi-snKPS 311
gi 71897301  229 NVPRSQFPYERRSSSAAYIpdGEGDFYYGGAVFGGLVKKVYEFTKICHMTILADKANGimaaWQEESHLNRHfl-thKPS 307
gi 55778210  223 VKTRHQFTYERRPQSQAYIpeDEGDFYYAGGYFGGKIEEVYKLTNHCHHAMLTDKANNieavWHDESYLNNYflyykKPT 302
gi 47215191  161 GMPRKAFPYQVEESSAAHVeeEEGDYYYTSELYGGAVSEVYRLVRACSLLILQDQANGvvarGLEESYLNRYli-dhRPT 239
gi 47229830  180 RLPKRFYTYDRNPKSVAYM--ERGDFYYHAAVFGGSWRWVKALTEACYQGIMEDKKNHvealWHDESHLNKFml-lhKPS 256
gi 119627868 238 HWPSWLLPFERDAHSAAAMawGQGDFYNHAAVFGGSVAALRGLTAHCAGGLDWDRARGlearWHDESHLNKFfw-lhKPA 316
gi 73967586  206 FKDIKDFPYERRFRSAACIllGEGDFYYDGSVVGGTPLEILDFIQEYLEGMIHDKENGl--nSTYERYLNKYff-thKPT 282
gi 84875495  203 FRKRTNLPYERKPTSVAHIpfGLGDFYYAGAIIGGVPFQVLDFAQQYLKGVFLDTENGv--nSTYEKYLNKYff-lnKPT 279
                        250       260       270
                 ....*....|....*....|....*....|....*.
Feature 1                                     # #   #
1K4V_A       252 KILSPEYCWdyhig-lpadIKLVKMSWQTKEYNVVR 286
1LZI_A       255 KVLSPEYLWdqqllgwpavLRKLRFTAVPKNHQAVR 290
gi 30354607  279 KLLSPEYLWrdini-sagqIRIVRFSHVAKNNAEVR 313
gi 67464687  312 KVLSPEYLWddrkp-qppsLKLIRFSTLDKDISCLR 346
gi 71897301  308 KLLSPEYLWddrkp-kppeIFLIRFSTVDKNYQEVR 342
gi 55778210  303 KILSPEYLWnerdg-tahyLRKRRLIALHKNPDEVR 337
gi 47215191  240 CVLSPEYSWwdsd--matnVPVPRLVSLGRQTRGSG 273
gi 47229830  257 RVLSPEYCWdpdig-qrtdIRVARLIWAPKDYEGLR 291
gi 119627868 317 KVLSPEFCWspdig-praeIRRPRLLWAPKGYRLLR 351
gi 73967586  283 KLLSPEYSWdt-------aLQLPAQIWLVKAAQCSH 311
gi 84875495  280 KLLSPEYSWdp-------tFNLPRHVWFVKIAHHPI 308

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap