4EGC,3HB0,3GEB


Conserved Protein Domain Family
HAD_Eya

?
cd02601: HAD_Eya 
Click on image for an interactive view with Cn3D
protein tyrosine phosphatase domain of the nuclear transcription factor of Eyes absent (Eya) and related phosphatase domains
Eyes absent (Eya) is a transcriptional coactivator, and an aspartyl-based protein tyrosine phosphatase. Eya and Six operate as a composite transcription factor, within a conserved network of transcription factors called the retinal determination (RD) network. The RD network interacts with a broad variety of signaling pathways to regulate the development and homeostasis of organs and tissues such as eye, muscle, kidney and ear. To date it is not clear what the physiologically relevant substrates of the Eya protein tyrosine phosphatase are, or whether this phosphatase activity plays a role in transcription. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.
Statistics
?
PSSM-Id: 319789
View PSSM: cd02601
Aligned: 12 rows
Threshold Bit Score: 365.276
Threshold Setting Gi: 18403799
Created: 23-Jun-2004
Updated: 18-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 12 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1              #####                                                                    
4EGC_B       23 IERVFVWDLDETIIIFHSLLTGTFAsry--gkdTTTSVRIGLMMEEMIFNLADTHLF-FNDLEDCDQIHVDDVSSDDNGQ 99
gi 30140326 268 LERIFVWDLDETIIIFHSLLTGIYAqry--qkdASTAVALGLRMEELIFSLADNHMF-FNDLEECDQVHIDDVSSDDNGQ 344
gi 544271   492 PERVFVWDLDETLIIFHTLLSGSYAnry--tkdHSSLMTIAFRMEEMVFNMADTHFF-FNEIEECDQVHIDDVSSDDNGQ 568
gi 18858653 338 LERVFIWDLDETIIVFHSLLTGSYAnrf--grdPPTSVSLGLRMEEMIFNLADTHFF-FNDLEECDQVHIDDVSSDDNGQ 414
gi 45382509 263 IERVFVWDLDETIIIFHSLLTGTFAsry--gkdTTTSVRIGLMMEEMIFNLADTHLF-FNDLEDCDQIHIDDVSSDDNGQ 339
gi 13591789 321 LERVFIWDLDETIIVFHSLLTGSYAnry--grdPPSSVSLGLRMEEMIFNLADTHLF-FNDLEECDQVHIDDVSSDDNGQ 397
gi 71068421 129 IERVFIWDLDETIIIFHSLLTSSYAqry--gkdTNATLQLGLRMEELIFNLADNHLF-FNDLEECDQVHCDDVAADDNGQ 205
gi 18403799  18 PVNVYVWDMDETLILLRSLLNGTYAesfngskdVKRGVEIGRMWEKHILKICDDFFF-YEQVEECNEPFLDSLRQYDDGK 96
gi 71982196 230 YARVFIWDIDDIAVISRNYLASVTHt-------NEFYARAANSVSHLMERIALNNFAdVNEFLEGDITNIEDAVVDETTM 302
gi 2661375  321 LERVFIWDLDETIIVFHSLLTGSYAnry--grdPPTSVSLGLRMEEMIFNLADTHLF-FNDLEECDQVHIDDVSSDDNGQ 397
3HB0_A        3 MERVFVWDLDETIIIFHSLLTGTFAsry--gkdTTTSVRIGLMMEEMIFNLADTHLF-FNDLEDCDQIHVDDVSSDDNGQ 79
3GEB_A        3 MERVFVWDLDETIIIFHSLLTGTFAsry--gkdTTTSVRIGLMMEEMIFNLADTHLF-FNDLEDCDQIHVDDVSSDDNGQ 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                            ##                                         
4EGC_B      100 DLSTYNFSADgfhss-------------apgaNLCLGSGVhggvDWMRKLAFRYRRVKEMYn--tYKNNVGGLIGtp--k 162
gi 30140326 345 DLSNYNFLVDgfagpasicngvstviqggplgLPGNTSVRgg-vDWMRKLAFRYRRIKELYn--sYRNNVGGLLGtq--k 419
gi 544271   569 DLSAYNFATDgfhtnt----------ppgappNLCLPTGVrggvDWMRKLAFRYRKIKDIYn--sYRGNVGTLLGpg--k 634
gi 18858653 415 DLSTYNFSTDgfhaa-------------atsaNLCLATGVrggvDWMRKLAFRYRRVKEIYt--tYKNNVGGLLGpa--k 477
gi 45382509 340 DLSTYNFSADgfhss-------------aasaNLCLGSGVhggvDWMRKLAFRYRRVKEMYn--tYKNNVGGLIGap--k 402
gi 13591789 398 DLSTYNFGTDgfpaa-------------atsaNLCLATGVrggvDWMRKLAFRYRRVKEIYn--tYKNNVGGLLGpa--k 460
gi 71068421 206 DLANYNFQTDgfrta-------------naagAICLGPGVrggvDWMRKLAFRYRRIKELYd--tFKDNIPELLSsp--v 268
gi 18403799  97 DLSRYEFKQD----------------------DFSTPTDD----LNKRKLAYRHRAVAERY----EKGLCPFIDSes-ms 145
gi 71982196 303 DSGPIDNLRGldvmr-------------rvapKYSAFRQFy--tENSTKNDVAGFKQEQNGfnfeLLERVGFGAReatel 367
gi 2661375  398 DLSTYNFGTDgfpaa-------------atsaNLCLATGVrggvDWMRKLAFRYRRVKEIYn--tYKNNVGGLLGpa--k 460
3HB0_A       80 DLSTYNFSADgfhss-------------apaaNLCLGSGVhggvDWMRKLAFRYRRVKEMYn--tYKNNVGGLIGtp--k 142
3GEB_A       80 DLSTYNFSADgfhss-------------apgaNLCLGSGVhggvDWMRKLAFRYRRVKEMYn--tYKNNVGGLIGtp--k 142
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
4EGC_B      163 RETWLQLRAELEalTDLWLTHSLKALNLIns-------------rpNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIY 229
gi 30140326 420 REHWLQLRQDIEtlTDNWLTLALKALTLIsq-------------rnNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIY 486
gi 544271   635 REAWLQIRSEIEvaTDNWATLALKCLSMIsq-------------reNCVNVLVTSTQLAPALAKVLLFGLGGIFNIENIY 701
gi 18858653 478 REAWLQLRAEIEalTDSWLTLALKALTLIhs-------------rsNCVNILVTTTQLIPALAKVLLYGLGVVFPIENIY 544
gi 45382509 403 RETWLQLRAELEalTDLWLTHALKALNLIhs-------------rpNCVNVLVTTTQLIPALAKVLLYGLGTVFPIENIY 469
gi 13591789 461 REAWLQLRAEIEalTDSWLTLALKALTLIhs-------------rtNCVNILVTTTQLIPALAKVLLYGLGIVFPIENIY 527
gi 71068421 269 GEAWRQLRTEIDqnTDNWCALALKALGLIhn-------------rpGCVNIMVTTTQLVPAIAKCMLYELGPVFNIDNVY 335
gi 18403799 146 GLDELYNVTDEY--TDRWLSSARAFLEQCscveessdgtsaieqssQDIHILVTSGALIPSLVKCLLFRLDTFLRHENVY 223
gi 71982196 368 YQSAIQLQTLPN--FGQRWPCAQRCMDLVveksk--------lsaeKYANVVLSNDGLVLGAAQLMISGLNSSVPVENIY 437
gi 2661375  461 REAWLQLRAEIEalTDSWLTLALKALSLIhs-------------rtNCVNILVTTTQLIPALAKVLLYGLGIVFPIENIY 527
3HB0_A      143 RETWLQLRAELEalTDLWLTHSLKALNLIns-------------rpNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIY 209
3GEB_A      143 RETWLQLRAELEalTDLWLTHSLKALNLIns-------------rpNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIY 209
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
Feature 1          #                       ##   ##                                
4EGC_B      230 SATKTGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKK-HNMPFWRISCHADLEALRHALELEYL 294
gi 30140326 487 SANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQ-VNWPFWRISSHSDIVALHHALSLGYL 551
gi 544271   702 SAHKIGHETCYERIVTRFGRKSTYVVIGDGNEEETAAKA-MNFPFWRISAHSDIRALYTALDMGFL 766
gi 18858653 545 SATKIGKESCFERVIQRFGRKVVYVVVGDGVEEEQGSKK-HNMPFWRISSHSDLMALHHALDLEYL 609
gi 45382509 470 SATKTGKESCFERIMQRFGRKAVYIVIGDGVEEEQGAKK-HNMPFWRISCHADLEALRHALELEYL 534
gi 13591789 528 SATKIGKESCFERIIQRFGRKVVYVVVGDGAEEEQGAKK-HSMPFWRITSHSDLMALHHALDLEYL 592
gi 71068421 336 SATKIGKESCFERIIQRFGKNVTYVCVGDGREEEIAAKT-HNVPFWPISTHNDLMALHQALELEYL 400
gi 18403799 224 SSIDVGKLQCFKWIKERFNHPKFRFCAIGDGWEECAAAQaLQWPFVKIDLQPDSSHRFPGLTPKTV 289
gi 71982196 438 SISKQGKESVFEKIQSRFGKKCSFICITSGDTANSAKRLnIPVWPLNSNTDLDKLYSALDNFLLGG 503
gi 2661375  528 SATKIGKESCFERIIQRFGRKVVYVVIGDGVEEEQGAKK-HAMPFWRISSHSDLMALHHALELEYL 592
3HB0_A      210 SATKTGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKK-HNMPFWRISCHADLEALRHALELEYL 274
3GEB_A      210 SATKTGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKK-HNMPFWRISCHADLEALRHALELEYL 274

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap