Conserved Protein Domain Family
LbH_MAT_GAT

?
cd03357: LbH_MAT_GAT 
Click on image for an interactive view with Cn3D
Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).
Statistics
?
PSSM-Id: 100047
View PSSM: cd03357
Aligned: 118 rows
Threshold Bit Score: 179.54
Threshold Setting Gi: 21218812
Created: 24-Jul-2006
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 30 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:Active galactoside acetyltransferase is trimeric, with active sites located at the interface between two LbH subunits. The trimer structure contains three active sites and each subunit contributes to two active sites via residues located on two surfaces.
  • Structure:1KRV; E. coli Galactoside Acetyltransferase trimer binds three CoA and substrate 4-nitrophenylgalactoside molecules; defined at 4A contacts.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1           #          #                                             #           # #     
1OCX_C        12 LYRSAdet--lsRDRLRARQLIHRYNHSLAeehtlRQQILADLFGQVt--eAYIEPTFRCDYGyNIFLGNNFFANFDCVM 87
1KRV_C        14 LFTDMceg--lpEKRLRGKTLMYEFNHSHPsevekRESLIKEMFATVge-nAWVEPPVYFSYGsNIHIGRNFYANFNLTI 90
gi 38232760    9 WHIPVspe--itQAMARTAELVFDYNATHPah-teELSRLRRLILSPaskdCTIRQPLTIEYGvNTTIGKDTFINYGVTI 85
gi 145297664  12 GALDSqse-eiaNDRIRGQALLAQLNASSAgdhplRQRLCGELFGHCpa-sSWISTPFTCEFGrNIHIGEQTFFNFNVTI 89
gi 29349278   12 LADMSap---elQVRFEHAKKLLAIMRGLStyddgYRELLEELVPGIpe-tSVICPPFHCDHGdGIKLGEHVFVNANCTF 87
gi 88799258   13 PYDAHcqe--miQIRTRVKGILHRLNVTEYyt-erFHDTMRELCPNSas-dVHLEPPFYCDYGeNIVAGEGVFINFGAVI 88
gi 86143404    6 PYDAHtpe--miALRKKTKHLLHKLNVTEYyt-enFQKTINELCPNAas-dLHLEPPFYCDYGdHIFAGEGVFINFGATI 81
gi 90408741   12 NYDPLape--feILRDSAFGLLQKINQCRFt---qAKPYYVKLLKHLge-nTVISTPFFCEYGvTISIGNNSFINMGATF 85
gi 15601591   13 EHFDGasa-eieALRSQAGRLKLEINQSLDea--eRYALQRELFGHLgh-kSCVQPPFHCEFGkTIRIGDHTFINMNVVM 88
gi 21218812    1 MYVHTpefarhaERIVEVTDATSRLNVLPFsdsagRSELLSVVFGGPlpesVTIYPPFFTEYGlNTTFGENVFVNQGCTF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        # #         # #     # # # #       ## #            # ##    #           ##  # ##  
1OCX_C        88 LDVCPIRIGDNCMLAPGVHIYTATHPIDPVARn-SGAELGK-PVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTKDV 165
1KRV_C        91 VDDYTVTIGDNVLIAPNVTLSVTGHPVHHELRk-NGEMYSF-PITIGNNVWIGSHVVINPGVTIGDNSVIGAGSIVTKDI 168
gi 38232760   86 LDTAEVTIGSQVLIGPNCQLITVTHPVDNADMrtAGWEIAH-PIVVGKQAWLGAGVIVLPGVTIGERAVIGAGSVVTHDI 164
gi 145297664  90 LDVGEVHIGNHVLLAPNVQIYTATHSMDYLERr-NWTAYNK-PVHIGDDCWIGGGAIICPGVTIGARSIIGAGAVVTRDI 167
gi 29349278   88 LDGGYITIGAHTLVGPCVQIYTPHHPMNYLERr-GSKEYAY-PVTIGEDCWIGGGAVICPGVTIGNRCVIGAGSVVTKDI 165
gi 88799258   89 LDGARVTIGRKTLIAPGVHIYTARHPVDVVER--REWEDCA-PVTIGEECWIGGHVTICPGVTIGDRAVVAAGSVVIRDV 165
gi 86143404   82 LDGAKVTIGRKTLIAPGLHIYTARHPLEIKER--REWEDCA-PVSIGEECWIGGRVTICPGVTIGDRAVIGAGSLVTKDI 158
gi 90408741   86 LDNAPINIGNYVLIGPNAQFYTPTHPLDHQRR--RQWEINClPIVVSDDVWIGGNVCICQGVHIGARAIIAAGSVVTRDV 163
gi 15601591   89 LDGAPITIGDHVLIGPSTQFYTASHSLDYRRRq-AWETICK-PIVIEDDVWIGGNVVINQGVTIGARSVVAANSVVNQDV 166
gi 21218812   81 MDKGGIRIGNRVMIAPKASLVTGGHPLPLAER--RAHLSFA-PIVVEDDVWIGTAAVITQGVTIGAGAVVAAGAVVTRDV 157
                        170
                 ....*....|....
Feature 1              #### #  
1OCX_C       166 PDNVVVGGNPARII 179
1KRV_C       169 PPNVVAAGVPCRVI 182
gi 38232760  165 PDDTIAYGNPARVI 178
gi 145297664 168 PADSVAVGNPARVI 181
gi 29349278  166 PDDSVAVGNPARLI 179
gi 88799258  166 PADTLVGGNPARYI 179
gi 86143404  159 PADTLAVGSPAKVV 172
gi 90408741  164 PADTLVGGSPAKFI 177
gi 15601591  167 PPDTLVGGTPARIL 180
gi 21218812  158 PAGTVVAGVPARVI 171

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap