Conserved Protein Domain Family
LbH_AT_putative

?
cd03360: LbH_AT_putative 
Click on image for an interactive view with Cn3D
Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain. The alignment contains 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity. A few members are identified as NeuD, a sialic acid (Sia) O-acetyltransferase that is required for Sia synthesis and surface polysaccharide sialylation.
Statistics
?
PSSM-Id: 100050
View PSSM: cd03360
Aligned: 176 rows
Threshold Bit Score: 137.231
Threshold Setting Gi: 114327804
Created: 19-Jul-2004
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
putative trimerputative CoA
Conserved site includes 15 residues -Click on image for an interactive view with Cn3D
Feature 1:putative trimer interface [polypeptide binding site]
Evidence:
  • Comment:Based on the trimer structures of some members of the superfamily including E. coli Maltose O-acetyltransferase, Chlamydia Trachomatis Lpxd, and E. coli serine acetyltransferase.
  • Comment:Most characterized members of the LbH superfamily form trimeric structures in their active form. However, there are a few members that form different quaternary structures such as Glucose-1-phosphate adenylyltransferase which forms a tetramer. Hence, not all members may form trimers.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
2NPO_A        11 IYGASGHGLVCEDVAKnm--gyKECIFLDDfkgmkfe----------------stlpkyDFFIAIGNn---eIRKKIYQK 69
gi 58582620   14 IIGAGEFAQIACEYFQhds-hyTVVAFSVErdfllqhtlaelpvvayeeleqryppeqyEVFVAIPAt---rLNRLRTRF 89
gi 88604346    6 IFGNSSFAQLVYYYLLnds-vfDIMGFTVDseyikedqfcnlpvfpyekieeqyppseyKMFIAIGYs---vVNTIRAQK 81
gi 149925689   9 IVGAGETALIAYEYFTvdt-dyEVVAFSVEsaylkekeqcglpvvpfeelqnsyspqevEAFVAISSt---kLNRIRKRL 84
gi 150017452   9 IIGDSAFAQIAYEYFTyds-dyEVVAFSVEkdylkdeemlglpvipledieklynpenhYVFVATVYkklnrLRTRLMKE 87
gi 151571076  10 IVGSGETALIAYEYFQyds-eyEIVAFSVSekylqdsslydlpivaletleekypttdyEIYVAISSg---kLNRSRTAV 85
gi 126737870   9 LIGAGEFADIAYEYFThds-dyEVVGFAVEqeflqeeekfglpvvsleeaeatfapdeiEAHVAVTSt---kLNQVREKL 84
gi 118030335   9 ILGDSAFAEVAYECFThds-dyEVVGFSVDsaylgrdqlfglpvvpfeeierffdpaevEFYAALVYs---qLNRLRTRF 84
gi 148264402   6 IFGNGQEAEMNYIYLThss-pyEVAAFTVDrayikedrllglpvvpfeniesiyppneyKMSLLISYr---kLNRLRAEK 81
gi 157911019   7 IFGTGDMAAVVAVYLRahapelRIVGYTLDdaycegdthdglplvpwsqletrfppdmfDLLGPLTYr---rMNTIRRDR 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                               # #   # #         #     # #         #    
2NPO_A        70 Iseng---fkiVNLIHKsaLISPSAIVEEnagILIMPyVVINAKAKIEKGVILNTSSVIEHECVIGEFSHVSVGAKCAGN 146
gi 58582620   90 FqdvvqrgyrcATYVSSraFVWHNAQIGAn--CFIFEgNVIQPFTRIGDNCVLWSGNHIGHRTAVRDHVFIASHAVISGY 167
gi 88604346   82 YhdakkkgyqlISYIGSkvNYWPDLKIGEn--CFIHEnPTIQPFVEIGNNVIINGSSYIAHDSFIKDHCYIAGSACIGGM 159
gi 149925689  85 YletkakgyrlASYVSPraFVWRNVEIGEn--CFVFEdNTLQPFVKLGNNIVLWSGNHIGHNTVIRDHCFLASQVVVSGY 162
gi 150017452  88 Ckdkg---yklASYISShaFVWKNVKIGEh--CFIFEnNVVQPFVELGNNTVLWSGNHIGHHSRFGDNCFVASHAVVSGF 162
gi 151571076  86 YnqikakgykcASYISSraFVWRNVEIGEn--CFIFEnNTLQPFVKVGNNVTLWSGNHIGHNTVIKDNCFISSHCVISGF 163
gi 126737870  85 ValakgkgfrlANFVSPhaFVWRTAKLGEn--VFIFEnNVVQHGVSIGDGVVLWSGNHVGHQTKIGDFAFISSHVVISGY 162
gi 118030335  85 FglakdkgyrpASYVSSraFVWPNAVIGEh--CFIFEdNTVQPFVKIGNNVVLWSGNHIGHHSTIEDNCFISSHAVISGF 162
gi 148264402  82 YdqakakgyelISYVNPkaVTWPGLVIGDn--CYIAEnSVICPFAEIGNNVFIGAGSLIGHHSVIKDHCFVAPHAVILGS 159
gi 157911019  84 YlegkargyafARFIHPd-CNIYTDQIGEn--CVILErNVLQPFSRVGNNCILWSGNHIGHHVTIGDHVFIASQVGIAGS 160
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*....
Feature 1        ## #         #    # # #                          
2NPO_A       147 VKIGKNCFLGINSCVLP-NLSLADDSILGGGATLVKNQD-EKGVFVGVP 193
gi 58582620  168 CEIGQGSFIGVNATLSD-KVHIAANNIIGAGALVTRHTE-AERVYVGSP 214
gi 88604346  160 VTIEPYCFVGMNTTIKD-HVIIRKMGIIGQGSVVNSDTD-EKGVYSGNP 206
gi 149925689 163 CEIGENCFLGVNSTLIN-NITLGEDCFIGAGALIQKSTE-AGQLIQAPS 209
gi 150017452 163 CNIGDNCFIGVNATIIN-NIKIGSDCIVGAGVLVLKDIE-SGKIVKGKA 209
gi 151571076 164 CEIGENSFLGVNSTVEN-NVKIARDNFLGARTLIQKDTP-EKAFYQEKQ 210
gi 126737870 163 CDIGRRSFVGVNASFAD-NVTVGADSFVALGAVVNKNYPdPGQILSGHY 210
gi 118030335 163 CTIGANTFIGVNSAIAN-NVVIGADNWLGVGVNILGNTE-PDCIFKGEQ 209
gi 148264402 160 ATIEPYCLIGANSTIRDgGVIVARECIIGAGVSITADTR-EKGVYINRA 207
gi 157911019 161 TVIGDACHIAGQVGITH-GLTIGAGCALVNGAFVSRDLA-PGSVVMGQS 207

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap