1Z06


Conserved Protein Domain Family
Rab33B_Rab33A

?
cd04115: Rab33B_Rab33A 
Click on image for an interactive view with Cn3D
Rab GTPase family 33 includes Rab33A and Rab33B
Rab33B/Rab33A subfamily. Rab33B is ubiquitously expressed in mouse tissues and cells, where it is localized to the medial Golgi cisternae. It colocalizes with alpha-mannose II. Together with the other cisternal Rabs, Rab6A and Rab6A', it is believed to regulate the Golgi response to stress and is likely a molecular target in stress-activated signaling pathways. Rab33A (previously known as S10) is expressed primarily in the brain and immune system cells. In humans, it is located on the X chromosome at Xq26 and its expression is down-regulated in tuberculosis patients. Experimental evidence suggests that Rab33A is a novel CD8+ T cell factor that likely plays a role in tuberculosis disease processes. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Statistics
?
PSSM-Id: 133315
View PSSM: cd04115
Aligned: 11 rows
Threshold Bit Score: 287.412
Threshold Setting Gi: 47218434
Created: 9-Aug-2005
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 18 residues -Click on image for an interactive view with Cn3D
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:
  • Comment:The active conformation of Rab is stabilized by interations between the gamma phosphate of GTP and two critically conserved residues, Thr in switch I and Gly in switch II
  • Structure:1Z06: Mus musculus Rab33 binds GppNHp, a GTP analog and Mg2+, defined using 3.5 A contacts
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                 #######         #   #  #                         #                    
1Z06_A       19 RIFKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVDIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVV 98
gi 3023913   14 RVFKIIVIGDSDVGKTCLTYRFCTGKFPEKTEATIGVDFRERTLDIDGEQIKLQLWDTAGQERFRKSMVPHYYRNVHAVV 93
gi 37589438  31 RIFKIIVIGDSNVGKTCLTYRFCTSCFPERTEATIGVDFRERTVDIDGERIKIQLWDTAGQERFRKSMVHHYYRNVHAVV 110
gi 3023915   99 RTFKVIIVGNAAVGKTCLSFRFCCGRFPEHTEATIGVDFRERSCVIENELLRVQLWDTAGQERYRQSIVAHYYRNVNAVV 178
gi 49522175  16 RIFKIIVIGDSNVGKTCLTFRFCGGGFPGSSEATIGVDFREKTVEIDGEKIKVQVWDTAGQERFRHSLVEHYYRNVHGVV 95
gi 54311161  32 RIFKIIVIGDSNVGKTCLTYRFCAGRFPDHTEATIGVDFRERAVEIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVV 111
gi 56605932  30 RIFKIIVIGDSNVGKTCLTYRFCAGRFPQRTEATIGVDFRERAVTIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVV 109
gi 71681216  25 RIFKIIVIGDSGVGKTCLTYRFCAGKFPDKTEATIGVDFREKVIEIDGEKIKVQLWDTAGQERFRKSMVQHYYRNVHAVV 104
gi 55925421  35 RVFKIIVIGDSNVGKTCLTYRFCGGKFLSNPEATIGVDFRERTLQLDGENIKLQIWDTAGQERFRKSMVEHYYRNVHAII 114
gi 47218434  31 RTFKVVVIGDSGVGKTCLTHRLCAGEFPRRVEATIGVDFRERLLNVDGENIKLQLWDTAGQERFRKSMVQHYYRNVHAVL 110
gi 2500071   35 RIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVV 114
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                             ## ##                                     
1Z06_A       99 FVYDMTNMASFHSLPAWIEECKQHlla--ndIPRILVGNKCDLrs--------------aIQVPTDLAQKFADTHs-mPL 161
gi 3023913   94 FTYDVTKGRSFQGLPSWIEECERYsln-aseIPRILVGNKCDLkd--------------qAEVDTNSATRFADANs-mPL 157
gi 37589438 111 FVYDITNMASFQSLPAWIEECKQHlis--ndVPRILVGNKCDLla--------------cIQVPTDMAQKFADSHs-mPM 173
gi 3023915  179 FVYDVTCRESFNDLALWIKECEKHglvgdseVPRILIGNKCDVec--------------tNRVSTDEAQMFADRNn-mAL 243
gi 49522175  96 FVYDVTKLSSFHNLRTWLQECEGHavp--alVPRVLVGNKCDLle--------------qVEVPSGLALNFAKAHk-mVL 158
gi 54311161 112 FVYDMTNMASFHSLPSWIEECKQHlla--ndIPRILVGNKCDLrs--------------aIQVPTDLAQKFADTHs-mPL 174
gi 56605932 110 FVYDMTNLASFHSLPSWIEECKQHllt--ndIPRILVGNKCDLrn--------------aIQVPTDLAQKFADTHs-mPL 172
gi 71681216 105 FVYDVTNAASFRSLPAWIEECRQHalg--qeVPRILVGNKCDLrh--------------aAQVSTDVAQQFADTHs-mPL 167
gi 55925421 115 FVYDVTSLASFESLPEWIEECNHHsvp--pmVPRILVGNKCDLre--------------sREVSTFLAQRLADSYn-fPL 177
gi 47218434 111 FVYDVTCPASFGSLTSWVEECRQNslg--heVPRYVAPGAQNVgrrrftavvlktrpsesSQVPRGQQERPPPPRrrrLP 188
gi 2500071  115 FVYDVTKMTSFTNLKMWIQECNGHavp--plVPKVLVGNKCDLre--------------qIQVPSNLALKFADAHn-mLL 177
                       170       180       190
                ....*....|....*....|....*....|....*
Feature 1          ###                             
1Z06_A      162 FETSAKnp--------ndNDHVEAIFMTLAHKLKS 188
gi 3023913  158 FETSAKad--------seMGNIEAIFLTVAHKLKS 184
gi 37589438 174 FETSAKr----------tNDHVEAIFMTLVHKLKS 198
gi 3023915  244 FETSAKla--------seADHVESIFLTLLHKLQQ 270
gi 49522175 159 FETSAKdp--------sqAKNVEKIFMSLACQLKA 185
gi 54311161 175 FETSAKnp--------ndNDHVEAIFMTLAHKLKS 201
gi 56605932 173 FETSAKnp--------ndNDHVEAIFMTLAHKLKS 199
gi 71681216 168 FETSAKnpygnedgtqnnSDHVEAIFMTVAHKLKS 202
gi 55925421 178 FETSARdl--------aeKEHVDAIFLTLAYRLKN 204
gi 47218434 189 GEPGASpel------rqsPQHDVFPDVCQEPAKKS 217
gi 2500071  178 FETSAKdp--------keSQNVESIFMCLACRLKA 204

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap