1Z0F


Conserved Protein Domain Family
Rab14

?
cd04122: Rab14 
Click on image for an interactive view with Cn3D
Rab GTPase family 14 (Rab14)
Rab14 GTPases are localized to biosynthetic compartments, including the rough ER, the Golgi complex, and the trans-Golgi network, and to endosomal compartments, including early endosomal vacuoles and associated vesicles. Rab14 is believed to function in both the biosynthetic and recycling pathways between the Golgi and endosomal compartments. Rab14 has also been identified on GLUT4 vesicles, and has been suggested to help regulate GLUT4 translocation. In addition, Rab14 is believed to play a role in the regulation of phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Statistics
?
PSSM-Id: 133322
View PSSM: cd04122
Aligned: 8 rows
Threshold Bit Score: 327.178
Threshold Setting Gi: 71661053
Created: 11-Jan-2006
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 14 residues -Click on image for an interactive view with Cn3D
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:
  • Comment:The active conformation of Rab is stabilized by interations between the gamma phosphate of GTP and two critically conserved residues, Thr in switch I and Gly in switch II
  • Structure:1Z0F: Human Rab14 binds GDP and Mg2+, defined using 3.5 A contacts
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                  ######         #                             #                       
1Z0F_A       14 YIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALM 93
gi 55926076  10 YIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALM 89
gi 28279556  10 YIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKVKLQIWDTAGQERFRAVTRSYYRGAAGALM 89
gi 28380367  28 YIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALM 107
gi 66813122   7 YIFKYIIIGDMGVGKSCLLHQFTENKFVPDSPHTIGVEFGTRIVDVNNKKIKLQIWDTAGQERFRAVTRSYYRGAAGALL 86
gi 71661053   5 YIFKYIIIGDMGVGKSCLMQRFTEQRFRNDLPHTIGVEFGTITVDINGETVKLQIWDTAGQERFRSVTRGYYRGAAGALL 84
gi 17568765  10 YIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALM 89
gi 29841087  11 YIFKYIIVGDMGVGKSCLMHQFTEKKFIPDCPHTIGVEFATKIVEVNDQKVKIQIWDTAGQERFRAVTRSYYRGAAGVLL 90
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                         ## ##                          ##             
1Z0F_A       94 VYDITrRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKtGENVEDAFLEAA 173
gi 55926076  90 VYDITrRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKtGENVEDAFLEAA 169
gi 28279556  90 VYDITrRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKtGENVEDAFLEAA 169
gi 28380367 108 VYDITrRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEEAKEFADENGLMFLEASAMtGQNVEEAFLETA 187
gi 66813122  87 VYDITrRITYNHLTTWLTDARNLTNPNTVIMLIGNKKDLEGQRDVTYEEASAFAKQNGLIFVESSAKtGENVEEAFLRTA 166
gi 71661053  85 VYDVSrRETFSRIGTWLQDARGNTNPHTVMMLVGNKSDLDESREVSYEEAVKFADENNLLFVECSALnGDNVEQAFLSTA 164
gi 17568765  90 VYDITrRSTYNHLSSWLADAKSLTNPNTAIFLIGNKADLEDQRDVPYEEAKAFAEENGLTFLECSAKtGSNVEDAFLETA 169
gi 29841087  91 VYDITrKLTFTRIQTWLTDARRLTSPDTVIFLIGNKADLDGQRDVTFEEAKLVADENDLMFLECSAKsGANVEEVFIETA 170

                ....*.
Feature 1             
1Z0F_A      174 KKIYQN 179
gi 55926076 170 KKIYQN 175
gi 28279556 170 KKIYQN 175
gi 28380367 188 RKIYQN 193
gi 66813122 167 KLIFQS 172
gi 71661053 165 HKIHEK 170
gi 17568765 170 KQIYQN 175
gi 29841087 171 RKIFQN 176

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap