Conserved Protein Domain Family
RSR1

?
cd04177: RSR1 
RSR1/Bud1p family GTPase
RSR1/Bud1p is a member of the Rap subfamily of the Ras family that is found in fungi. In budding yeasts, RSR1 is involved in selecting a site for bud growth on the cell cortex, which directs the establishment of cell polarization. The Rho family GTPase cdc42 and its GEF, cdc24, then establish an axis of polarized growth by organizing the actin cytoskeleton and secretory apparatus at the bud site. It is believed that cdc42 interacts directly with RSR1 in vivo. In filamentous fungi, polar growth occurs at the tips of hypha and at novel growth sites along the extending hypha. In Ashbya gossypii, RSR1 is a key regulator of hyphal growth, localizing at the tip region and regulating in apical polarization of the actin cytoskeleton. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Statistics
?
PSSM-Id: 133377
View PSSM: cd04177
Aligned: 5 rows
Threshold Bit Score: 297.087
Threshold Setting Gi: 71008203
Created: 20-Mar-2006
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
  next features
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:
  • Comment:Based on sequence similarity to Ras, bound to Mg2+/GTP analog

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                #######                                      #  #                      
gi 134042     3 DYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSYRKTIEIDNKVFDLEILDTAGIAQFTAMRELYIKSGMGFLLVY 82
gi 3434937   12 EFHIVVLGTGGVGKSCLTAQFVHNEWIESYDPTIEDSYRTQVAVDGRQVILEILDTAGTEQFVAMRDLYMKAGQGFLLVF 91
gi 49651647   3 DYKIVVLGAGGVGKSAITVQYVQDIFIESYDPTIEDSYCKKVNLDGRHCTMEILDTAGVEQFTAMRELYIRNGEGFVLVY 82
gi 1710782    3 DYKVVVLGAGGVGKSSITVQFVQGVYVESYDPTIEDSYRKQIEVDGRACDLEILDTAGVAQFTAMRELYIKSGKGFLLVY 82
gi 71008203 146 ESRVVIMGGGGVGKSALTVQFVRNVFVSTYDPTIEDTYRKLLVIDGQQCMVEILDTAGTEQFLALKELYIKSGQGFILVF 225
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                        ## #                           ##              
gi 134042    83 SVTDRQSLEELMELREQVLRIKDSDRVPMVLIGNKADLINERVISVEEGIEVSSKWgrVPFYETSALLRSNVDEVFVDLV 162
gi 3434937   92 SITSQASLDELATLREEIIRIKDDENIPIVMVGNKADLLDQRAVDRAKAFTISQQWn-APYYEASARTRTNVDEVFIDLC 170
gi 49651647  83 SVNSESSLRELQELRQQVCRIKDNNNVPMVLVGNKCDLENERQVQPRDGVALANQWgkVPFYETSAKFKTNIDQVFQDLL 162
gi 1710782   83 SVTDENSLKELLALREQVLRIKDSDNVPMVLVGNKCDLEDDRVLSIEDGVKVSQDWglVPFYETSAMYKTNVDEAFIDVV 162
gi 71008203 226 SLTSLASVNELGPLREAIVRIKDTTAIPIVLVGNKADLRADRQVPREVGTSLSKAWgnVPYYEASARKRINVDEVFADAV 305
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 134042   163 RQIIrnemesvavkdarnqsqqfskiespstrlpssakqdtkqsnnkqsskglynkssqgqakvkqstpvnekhkpshav 242
gi 3434937  171 RQMLrrddsgqlddddgarngsgygygq---------------------------------------------------- 198
gi 49651647 163 RQIIrrdssfggstvslagtsgmgvsspthsptsstgadylnmpyd------------------draskhvsvkstssaa 224
gi 1710782  163 RQIMrkeaaisaekkqqkelqkqqqqqqqeqdaegqqqqqksg------------------------kskssatqkdata 218
gi 71008203 306 RQIRafdaingkpsnghsvrhtfastgsv--------------------------------------------------- 334
                       250       260       270
                ....*....|....*....|....*....|
Feature 1                                     
gi 134042   243 pksgssnrtgisatsqqkkkkknastCTIL 272
gi 3434937  199 ---gkqedghgpmkkkrrrkrkgdhkCIIM 225
gi 49651647 225 sirnistsfkghqrknsevkkkkkkgCVIM 254
gi 1710782  219 dgqtdvnarlkqsindhpksssgskfCTII 248
gi 71008203 335 --nstkdakmaantfgaasrsrdrkkCVIM 362

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap